KEGG   Mus musculus (mouse): 17087Help
Entry
17087             CDS       T01002                                 

Gene name
Ly96, ESOP-1, MD-2, MD2
Definition
(RefSeq) lymphocyte antigen 96
  KO
K05400  lymphocyte antigen 96
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04620  Toll-like receptor signaling pathway
mmu05133  Pertussis
mmu05145  Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    17087 (Ly96)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    17087 (Ly96)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05133 Pertussis
    17087 (Ly96)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    17087 (Ly96)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_DerP2_DerF2
Motif
Other DBs
NCBI-GeneID: 17087
NCBI-ProteinID: NP_058619
MGI: 1341909
Ensembl: ENSMUSG00000025779
Vega: OTTMUSG00000048080
UniProt: Q9JHF9 Q14AM4
LinkDB All DBs
Structure
PDB: 

Position
1; 1 A3
AA seq 160 aa AA seqDB search
MLPFILFSTLLSPILTESEKQQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGF
VHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFS
FEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRRDVN
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgttgccatttattctcttttcgacgctgctttctcccatattgactgaatctgagaag
caacagtggttctgcaactcctccgatgcaattatttcctacagttattgtgatcacttg
aaattccctatttcaattagttctgaaccctgcataagactgaggggaaccaatggattt
gtgcatgttgagttcattccaagaggaaacttaaaatatttatatttcaacctattcatc
agtgtcaactccatagagttgccgaagcgtaaggaagttctgtgccatggacatgatgat
gactattctttttgcagagctctgaaaggagagactgtgaatacatcaataccattctct
ttcgagggaatactatttcctaagggccattacagatgtgttgcagaagctattgctggg
gatactgaagaaaagctcttctgtttgaatttcaccatcattcaccgccgtgatgtcaat
tag

DBGET integrated database retrieval system