KEGG   Mus musculus (house mouse): 171171
Entry
171171            CDS       T01002                                 
Symbol
Ntng2, 2610016D08Rik, Lmnt2
Name
(RefSeq) netrin G2
  KO
K16359  netrin-G2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04360  Axon guidance
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    171171 (Ntng2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    171171 (Ntng2)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF EGF EGF_2 hEGF
Other DBs
NCBI-GeneID: 171171
NCBI-ProteinID: NP_598008
MGI: 2159341
Ensembl: ENSMUSG00000035513
UniProt: Q8R4F1 A2AKW8
LinkDB
Position
2:complement(29084738..29138111)
AA seq 589 aa
MLRLLALFLHCLPLVSGDYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGIT
CGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDREDEGLATYWQSVTWSRYPSPLE
ANITLSWNKSVELTDDVVVTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSAR
RARDMSPSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRMESA
KGLKEFFTFTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCTVRE
GSLQCECEHNTTGPDCGRCKKNFRTRAWRAGSYLPLPHGSPNACAAAGSAFGSQTKPPTM
APLGDSSFWPQVSSSAEAVAISVAVPSQAKDSTLFELKPRSPQVIPIEEFQDCECYGHSN
RCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHDR
CNETGFCECREGAVGPKCDDCLPTHYWRQGCYPNVCDDDQLLCQNGGTCQQNQRCACPPG
YTGIRCEQPRCDLADDAGPDCDRAPGIVPRPDTLLGCLLLLGLAARLAC
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgctgcgcctgctggctctcttcctgcactgcctcccgctggtctctggggactatgac
atctgcaaatcctgggtgaccacagatgagggccccacctgggaattctatgcctgccag
cccaaggtgatgcgcctgaaggattatgtcaaggtcaaagtggagccctcaggcatcacg
tgcggagacccccctgaaaggttctgttcccatgagaacccctacctgtgcagtaatgag
tgtgatgcctccaatcccgacctggcccacccgccccggcttatgtttgacagggaagat
gagggactggctacctactggcaaagcgtcacgtggagtcgctaccccagtccactagag
gccaacatcaccctctcatggaacaagagcgtggagttgacagacgacgtggtggtgact
tttgagtatggccggcccacggtcatggtcctcgagaagtccctggacaatggccgcacc
tggcagccctaccagttctatgcagaggactgcatggaggccttcggcatgtctgcccga
cgtgcccgagacatgtcaccctccagcgcccaccgggtgctctgcaccgaggagtactca
cgctgggcagggtccaagaaagagaagcatgtgcgctttgaggtaagggaccgctttgcc
atctttgccggccctgacctgcgtaacatggacaacctgtacacgaggatggagagcgcc
aagggcctcaaggagttcttcaccttcactgacctgcgcatgcgcctgctgcgtcctgcg
ctgggtggcacctacgtgcagcgagagaacctctacaagtacttctatgccatctccaat
atcgaagtcattggcaggtgtaagtgcaacctgcatgccaacctgtgcacagtgcgagag
ggcagcctgcagtgtgagtgtgaacacaacaccacgggccccgactgtggcaggtgcaag
aagaacttccgcacacgcgcctggcgagctggctcctacctgccgctgccccacggctct
cccaatgcctgtgcggccgcgggctccgcctttggcagtcagaccaagccacctactatg
gccccccttggggacagctccttctggccccaggtgtcctccagtgcagaagctgtagct
atctctgtcgctgtcccttcccaagccaaggactctacgcttttcgagctcaagcccaga
tctcctcaggtgatacccattgaagaatttcaagactgcgagtgctacggccactccaac
cgttgcagctacattgacttcctgaacgtggtgacctgcgtcagctgtaaacacaacact
cgaggccaacactgtcagcactgccgcctgggctactatcgcaatggctccgcagagctg
gatgatgagaacgtctgcattgaatgtaactgtaaccagatcggctctgtgcacgatcga
tgcaatgagacaggcttctgcgagtgcagggagggcgcagtggggcccaagtgcgacgac
tgccttcctacacactactggcgccaaggatgctatcccaatgtgtgcgacgatgaccag
ctgctctgccagaatggcggcacctgccagcagaaccaacgctgcgcctgcccgcccggc
tacaccggcattcgctgtgagcagccccgctgtgacctcgccgacgacgctggcccggac
tgtgaccgcgcgccaggcatcgtcccgcgccccgacaccctgctcggatgcctgctgctg
ctcgggctggccgcccgtctggcctgctga

DBGET integrated database retrieval system