KEGG   Mus musculus (house mouse): 17136
Entry
17136             CDS       T01002                                 
Symbol
Mag, Gma, siglec-4a
Name
(RefSeq) myelin-associated glycoprotein
  KO
K06771  myelin associated glycoprotein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    17136 (Mag)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    17136 (Mag)
   04091 Lectins [BR:mmu04091]
    17136 (Mag)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  MAG
   17136 (Mag)
Lectins [BR:mmu04091]
 I-type lectins (Siglecs)
  17136 (Mag)
SSDB
Motif
Pfam: Ig_3 Ig_2 I-set V-set ig C2-set_2 Ig_5 Ig_4 Ig_C17orf99 Izumo-Ig
Other DBs
NCBI-GeneID: 17136
NCBI-ProteinID: NP_001333013
MGI: 96912
Ensembl: ENSMUSG00000036634
UniProt: P20917 Q3ZB60
Structure
LinkDB
Position
7:complement(30598600..30614347)
AA seq 627 aa
MIFLATLPLFWIMISASRGGHWGAWMPSTISAFEGTCVSIPCRFDFPDELRPAVVHGVWY
FNSPYPKNYPPVVFKSRTQVVHESFQGRSRLLGDLGLRNCTLLLSTLSPELGGKYYFRGD
LGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPELRPELSWLGHEGL
GEPTVLGRLREDEGTWVQVSLLHFVPTREANGHRLGCQAAFPNTTLQFEGYASLDVKYPP
VIVEMNSSVEAIEGSHVSLLCGADSNPPPLLTWMRDGMVLREAVAKSLYLDLEEVTPGED
GVYACLAENAYGQDNRTVELSVMYAPWKPTVNGTVVAVEGETVSILCSTQSNPDPILTIF
KEKQILATVIYESQLQLELPAVTPEDDGEYWCVAENQYGQRATAFNLSVEFAPIILLESH
CAAARDTVQCLCVVKSNPEPSVAFELPSRNVTVNETEREFVYSERSGLLLTSILTIRGQA
QAPPRVICTSRNLYGTQSLELPFQGAHRLMWAKIGPVGAVVAFAILIAIVCYITQTRRKK
NVTESSSFSGGDNPHVLYSPEFRISGAPDKYESEKQRLGSERRLLGLRGESPELDLSYSH
SDLGKRPTKDSYTLTEELAEYAEIRVK
NT seq 1884 nt   +upstreamnt  +downstreamnt
atgatattcctcgccaccctgccgctgttttggataatgatttcagcttctcgagggggc
cactggggtgcctggatgccctcgaccatctcagccttcgagggcacgtgtgtctccatt
ccctgccgtttcgacttccccgatgagctcagaccggctgtggtacatggcgtctggtat
ttcaatagtccctaccccaagaactacccaccggtggtcttcaagtcccgcacacaagtg
gtccatgagagtttccagggccgcagccgcctattgggagacctgggcctacgaaactgt
accctgcttctcagcacactgagccccgagctgggaggcaaatactatttccgaggcgac
ctgggtggctacaaccagtacaccttctcggagcacagcgtcctggacatcgtcaacacc
cccaacattgtggttcccccggaagtggtggcaggaacggaagtggaggtcagttgtatg
gtgccggacaactgcccagagctgcggccagagctgagctggctgggccacgaggggctg
ggagagcccactgtgctgggtcggctgcgtgaggatgaaggcacctgggtgcaggtgtcg
ctgctacacttcgtgcctactagagaggccaacggccaccgtctgggctgtcaggctgcc
ttccccaacaccaccttgcagttcgagggttacgccagtttggacgtcaagtacccccca
gtgattgtggagatgaattcctctgtggaggccattgagggctcccatgtcagcctgctc
tgtggggctgacagcaacccgccgccgctgctgacttggatgcgggatgggatggtgttg
agggaggcagttgccaagagcctgtacctggatctggaggaggtgaccccaggagaggac
ggcgtctatgcttgcctagcagagaacgcctatggccaggacaaccgcacggtggagctg
agtgtcatgtatgcaccttggaagcccacagtgaatgggacggtggtggccgtagagggg
gagactgtctctatcctgtgttccacacagagcaacccggaccccatccttaccatcttc
aaggagaagcagatcctagccacggtcatctatgagagtcagctgcagctggaactccct
gcagtgacccccgaggatgatggggaatactggtgtgtggctgagaaccagtatggccag
agagccactgccttcaacctgtctgtggagtttgcccccataatccttctggagtcacac
tgtgcagcggccagagacaccgtgcagtgtctatgtgtggtaaaatccaacccggaaccc
tctgtggcctttgagctgccttcccgcaacgtgactgtgaatgagacggagagggagttt
gtgtactccgagcgcagtggcctcctgctcaccagcatcctcacgatccggggtcaggcc
caagccccaccccgcgtcatttgtacctccaggaacctctatggcacccagagcctcgag
ctgcctttccagggagcacaccgactgatgtgggccaaaatcggtcctgtgggtgctgtg
gtcgcctttgccatcctgattgccattgtgtgctacatcacccagacgagaagaaaaaag
aatgtcacggagagctccagcttctcagggggagacaaccctcatgtcctgtacagcccc
gaattcagaatctctggggcacctgataagtatgagagtgagaagcagcgcctgggatct
gagaggaggctgctgggccttcggggggaatccccagaactggacctcagttattcccac
tcagacctgggaaaacgacccaccaaggacagctacaccctgacagaggagctggctgag
tatgcagaaatccgagtcaagtga

DBGET integrated database retrieval system