Mus musculus (house mouse): 17463
Help
Entry
17463 CDS
T01002
Symbol
Psmd7, Mov-34, Mov34
Name
(RefSeq) proteasome (prosome, macropain) 26S subunit, non-ATPase, 7
KO
K03038
26S proteasome regulatory subunit N8
Organism
mmu
Mus musculus (house mouse)
Pathway
mmu03050
Proteasome
mmu05010
Alzheimer disease
mmu05012
Parkinson disease
mmu05014
Amyotrophic lateral sclerosis
mmu05016
Huntington disease
mmu05017
Spinocerebellar ataxia
mmu05020
Prion disease
mmu05022
Pathways of neurodegeneration - multiple diseases
mmu05169
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:
mmu00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
17463 (Psmd7)
09160 Human Diseases
09172 Infectious disease: viral
05169 Epstein-Barr virus infection
17463 (Psmd7)
09164 Neurodegenerative disease
05010 Alzheimer disease
17463 (Psmd7)
05012 Parkinson disease
17463 (Psmd7)
05014 Amyotrophic lateral sclerosis
17463 (Psmd7)
05016 Huntington disease
17463 (Psmd7)
05017 Spinocerebellar ataxia
17463 (Psmd7)
05020 Prion disease
17463 (Psmd7)
05022 Pathways of neurodegeneration - multiple diseases
17463 (Psmd7)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
mmu03051
]
17463 (Psmd7)
Proteasome [BR:
mmu03051
]
Eukaryotic proteasome
Regulatory particles
PA700 (19S proteasome)
non-ATPase subunits
17463 (Psmd7)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MitMem_reg
JAB
Coilin_N
Connexin
Motif
Other DBs
NCBI-GeneID:
17463
NCBI-ProteinID:
NP_034947
MGI:
1351511
Ensembl:
ENSMUSG00000039067
UniProt:
P26516
A1L3B8
LinkDB
All DBs
Position
8:complement(108307012..108315114)
Genome browser
AA seq
321 aa
AA seq
DB search
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVASGKLPINHQIIYQLQDVFNLLPDA
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKER
KDDKEKEKSDAAKKEEKKEKK
NT seq
966 nt
NT seq
+upstream
nt +downstream
nt
atgccggagctggcggtgcagaaggtggtggttcaccccctggtgctgctcagtgtggtg
gatcatttcaaccgaattggcaaggttggaaaccagaagcgggtagttggtgtgcttttg
ggatcatggcaaaagaaagtacttgatgtatccaacagttttgcagtaccttttgatgaa
gatgacaaagatgattctgtctggtttttagaccatgattatttggaaaacatgtatggg
atgttcaagaaggtcaatgccagagaaaggatagttgggtggtaccacacaggccccaaa
ctgcacaagaatgatatcgccatcaatgaactcatgaagagatactgccccaactcagta
ttggtcattatcgacgtgaagccaaaggacctaggacttcccaccgaagcctacatctca
gtggaggaagttcatgacgatgggacgccaacgtcaaaaacttttgagcatgtgactagc
gagattggagcagaggaggcggaggaagtcggagtggagcacttactaagagacatcaag
gacactacagtggggactctctcccagcggatcacaaaccaggtccatggcttgaaggga
ctgaactccaagctcctggatatcaggagctacctggagaaggtagccagcggcaagctg
cccatcaaccaccagatcatataccagctgcaggacgtcttcaacctgctgccggacgcc
agcctgcaggagtttgtcaaggccttctacctgaagaccaatgaccagatggtggtggtg
tacctggcctcgctgatccgctctgtggtcgccttgcataacctcatcaacaacaagatt
gccaaccgggatgccgagaagaaggagggacaggaaaaggaggagagcaagaaggagaga
aaagacgacaaagagaaggagaagagcgacgcagcgaagaaagaagagaaaaaggagaaa
aagtaa
DBGET
integrated database retrieval system