KEGG   Mus musculus (house mouse): 17532
Entry
17532             CDS       T01002                                 
Symbol
Mras, 2900078C09Rik
Name
(RefSeq) muscle and microspikes RAS
  KO
K07831  Ras-related protein M-Ras
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04218  Cellular senescence
mmu04371  Apelin signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    17532 (Mras)
   04014 Ras signaling pathway
    17532 (Mras)
   04015 Rap1 signaling pathway
    17532 (Mras)
   04371 Apelin signaling pathway
    17532 (Mras)
   04072 Phospholipase D signaling pathway
    17532 (Mras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    17532 (Mras)
   04137 Mitophagy - animal
    17532 (Mras)
  09143 Cell growth and death
   04218 Cellular senescence
    17532 (Mras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    17532 (Mras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    17532 (Mras)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    17532 (Mras)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    17532 (Mras)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    17532 (Mras)
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N AAA_16 CbiA MMR_HSR1_Xtn
Other DBs
NCBI-GeneID: 17532
NCBI-ProteinID: NP_032650
MGI: 1100856
Ensembl: ENSMUSG00000032470
UniProt: O08989 Q3TPX5
Structure
LinkDB
Position
9:complement(99267473..99319505)
AA seq 208 aa
MATSAVPSENLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQW
AILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFP
MILVANKVDLMHLRKVTRDQGKEMATKYNIPYIETSAKDPPLNVDKTFHDLVRVIRQQVP
EKNQKKKKKTKWRGDRATGTHKLQCVIL
NT seq 627 nt   +upstreamnt  +downstreamnt
atggcgaccagcgctgttccaagtgaaaaccttcccacatataaactagtagtggtggga
gatggtggtgtgggcaagagtgcgctcactattcagtttttccagaagatctttgtgcct
gactacgaccccaccattgaagactcctacctgaagcatacagagattgacaatcagtgg
gccatcttggatgttctggacacagccgggcaggaggagttcagtgccatgcgggaacaa
tacatgcgcacaggggatggcttcctcattgtctactccgtcaccgacaaggccagcttc
gagcacgtggaccgcttccaccagctcattctgcgtgtcaaggacagggagtcattccca
atgatcctcgtggccaacaaggtggatctgatgcacctaaggaaagtcaccagggaccaa
ggaaaagaaatggcaaccaaatacaatatcccatatatagagaccagtgccaaggacccg
cctctcaacgtggataaaaccttccatgacctagttagagtaattaggcaacaggttcca
gagaaaaaccagaagaagaaaaagaagacaaaatggcgaggagacagggccaccggcact
cacaaactgcagtgtgtcatcttgtga

DBGET integrated database retrieval system