KEGG   Mus musculus (house mouse): 18007
Entry
18007             CDS       T01002                                 
Symbol
Neo1, 2610028H22Rik, AI327052, D930014N22Rik, Igdcc2
Name
(RefSeq) neogenin
  KO
K06766  neogenin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04350  TGF-beta signaling pathway
mmu04360  Axon guidance
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    18007 (Neo1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    18007 (Neo1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    18007 (Neo1)
SSDB
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 Ig_2 ig Pur_ac_phosph_N V-set Interfer-bind C2-set_2 Ig_5 fn3_2 Tissue_fac SusE Izumo-Ig TMEM154 EphA2_TM Herpes_UL74 FAM176
Other DBs
NCBI-GeneID: 18007
NCBI-ProteinID: NP_001036217
MGI: 1097159
Ensembl: ENSMUSG00000032340
UniProt: Q7TQG5
Structure
LinkDB
Position
9:complement(58781962..58943926)
AA seq 1465 aa
MAAEREAGRLLCTSSSRRCCPPPPLLLLLPLLLLLGRPASGAAATKSGSPPQSAGASVRT
FTPFYFLVEPVDTLSVRGSSVILNCSAYSEPSPNIEWKKDGTFLNLESDDRRQLLPDGSL
FISNVVHSKHNKPDEGFYQCVATVDNLGTIVSRTAKLTVAGLPRFTSQPEPSSVYVGNSA
ILNCEVNADLVPFVRWEQNRQPLLLDDRIVKLPSGTLVISNATEGDGGLYRCIVESGGPP
KFSDEAELKVLQDPEEIVDLVFLMRPSSMMKVTGQSAVLPCVVSGLPAPVVRWMKNEEVL
DTESSGRLVLLAGGCLEISDVTEDDAGTYFCIADNGNKTVEAQAELTVQVPPGFLKQPAN
IYAHESMDIVFECEVTGKPTPTVKWVKNGDVVIPSDYFKIVKEHNLQVLGLVKSDEGFYQ
CIAENDVGNAQAGAQLIILEHDVAIPTLPPTSLTSATTDHLAPATTGPLPSAPRDVVASL
VSTRFIKLTWRTPASDPHGDNLTYSVFYTKEGVARERVENTSQPGEMQVTIQNLMPATVY
IFKVMAQNKHGSGESSAPLRVETQPEVQLPGPAPNIRAYATSPTSITVTWETPLSGNGEI
QNYKLYYMEKGTDKEQDIDVSSHSYTINGLKKYTEYSFRVVAYNKHGPGVSTQDVAVRTL
SDVPSAAPQNLSLEVRNSKSIVIHWQPPSSTTQNGQITGYKIRYRKASRKSDVTETLVTG
TQLSQLIEGLDRGTEYNFRVAALTVNGTGPATDWLSAETFESDLDETRVPEVPSSLHVRP
LVTSIVVSWTPPENQNIVVRGYAIGYGIGSPHAQTIKVDYKQRYYTIENLDPSSHYVITL
KAFNNVGEGIPLYESAVTRPHTVPDPTPMMPPVGVQASILSHDTIRITWADNSLPKHQKI
TDSRYYTVRWKTNIPANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTA
HGATFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDW
VIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPKALGSAGKGSRLP
DLGSDYKPPMSGSNSPHGSPTSPLDSNMLLVIIVSVGVITIVVVVVIAVFCTRRTTSHQK
KKRAACKSVNGSHKYKGNCKDVKPPDLWIHHERLELKPIDKSPDPNPVMTDTPIPRNSQD
ITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGRRGMRPKMMMPFDSQPPQPVISAHPIH
SLDNPHHHFHSSSLASPARSHLYHPSSPWPIGTSMSLSDRANSTESVRNTPSTDTMPASS
SQTCCTDHQDPEGATSSSYLASSQEEDSGQSLPTAHVRPSHPLKSFAVPAIPPPGPPLYD
PALPSTPLLSQQALNHHIHSVKTASIGTLGRSRPPMPVVVPSAPEVQETTRMLEDSESSY
EPDELTKEMAHLEGLMKDLNAITTA
NT seq 4398 nt   +upstreamnt  +downstreamnt
atggcggcggagcgcgaagccgggcgactcctctgcacctcctcctcccggcgctgctgt
ccgccaccgccgctgctgctgttgctgccgctgctgctgctgctcggacgcccggcgtcc
ggcgccgcggccacgaagagcggctccccgccgcagtccgcaggagccagtgttcgaaca
ttcactccgttttattttctggtggagccagtagacaccctctcagttagaggctcttct
gttatattaaattgctcggcatattctgagccctctccaaacattgaatggaagaaagat
gggacttttttaaacttagaatcagatgatcgacgccagctactcccagatggatcttta
ttcatcagcaacgtggtgcattccaaacacaataagcctgacgaaggtttctatcagtgt
gtagccactgtggataatcttggaaccattgtcagcagaacagccaagctcacagtagca
ggtcttccaagatttaccagccaaccagaaccttcttcagtctatgttggaaacagtgca
attctgaattgtgaagttaatgcagatttggtcccatttgttaggtgggaacagaatcga
cagccccttcttctagatgacaggattgtcaaacttccaagtggaacactggttatcagc
aatgctactgaaggagatgggggactctaccgctgcattgttgaaagtggtgggccacca
aagtttagtgacgaagctgaattgaaagttcttcaagatcctgaggaaattgtagacttg
gtatttctgatgcgaccatcttctatgatgaaagtcactggtcagagtgcagtgttgcca
tgtgttgtctcagggcttcctgctccagttgttagatggatgaaaaacgaagaagtgctt
gacacagaaagctctggcaggttggtcttgctagcaggaggttgcttggagatcagtgat
gtcactgaggatgatgctgggacttatttttgcatagctgataatggaaataagacagtt
gaagctcaggcggagcttactgtgcaagtgccacctggattcctgaaacaacctgctaac
atatatgctcacgaatccatggacattgtatttgaatgtgaagtcactgggaagccaact
ccaactgtgaagtgggtcaagaatggggatgtggttatccccagtgattactttaaaatt
gtaaaggaacataatcttcaagttttgggtctggtgaaatcagatgaagggttctatcaa
tgcattgctgagaatgatgttggaaatgcacaagctggagcccagctgataatccttgag
catgatgttgccatcccaacattacctcccacttcactgaccagtgccactactgaccat
ctagcaccagccacaacgggaccattaccttcagctcctcgagacgtcgtggcctccctg
gtctctactcgcttcattaaattgacatggcgtacacctgcatcagaccctcatggagac
aatctcacctactctgtgttctacaccaaggaaggggttgctagggagcgtgttgagaat
accagccagccaggagagatgcaggtgactattcaaaacttgatgccagcaactgtgtac
atcttcaaagttatggctcaaaataagcatggctctggagaaagttcagctcctcttcga
gtagagacacagcctgaggttcagctccctggcccagcacctaatatccgtgcttatgca
acgtcacctacttctatcactgtcacctgggaaacaccgttatctggcaatggggaaatt
caaaattacaaattgtactacatggaaaaaggaactgataaagaacaggatattgatgtt
tcaagtcactcctacaccattaatggactgaagaaatacacagaatacagtttccgagtg
gtggcctacaataaacatggtcctggagtttctacacaagatgttgctgttcgaacatta
tcagatgttcccagtgctgctcctcagaatctgtccttagaagtgagaaattcaaagagt
atagtgatccactggcagcccccttcctcaaccacacaaaatgggcagataactggctac
aagattcgatatcgaaaggcctcccgaaaaagtgatgtcactgagaccttggtaactggg
acacagctgtctcagctgattgaaggtcttgatcgggggacagaatataacttccgagtc
gctgctctcacagtcaatggtacaggtccagcaactgattggctgtctgctgaaactttt
gaaagcgacctagatgaaactcgtgttcctgaagtgcccagctctcttcatgtccgtccg
ctcgtcactagcattgtagtgagctggactcctccagagaaccagaacattgtggtccga
ggttatgccatcggttacggcattggcagccctcatgcccagaccatcaaagtggactat
aaacaacgttattacaccatcgaaaacttggatccaagctctcattacgtgattaccttg
aaagcatttaacaatgttggcgaaggcatccccctttatgagagtgctgtgaccagacct
cacacagtgccagatcccactcccatgatgccaccagtgggagttcaggcttccattctg
agtcacgacaccataaggattacctgggcagacaactccctgcccaaacaccagaagatt
acagactcccgctactacacagtccggtggaagaccaacatcccagcaaacacgaagtac
aagaatgcaaatgcaacgacgttaagctatttggttactggtttaaagccaaatacgctc
tatgagttctctgtgatggtgaccaaaggcagaaggtcaagcacgtggagtatgacagct
catggcgctacctttgaattagttcctacttctccacctaaggatgtgacagttgtgagt
aaggaaggaaaacctagaaccatcatagtgaattggcagcctccctctgaagctaacggc
aagattacaggttacatcatctattacagcacggatgtgaatgcagagatacatgactgg
gttattgaaccagttgtgggaaacagactgactcaccagattcaagagttaacacttgat
acgccatactacttcaaaatccaggcccggaactcaaagggcatggggcccatgtctgaa
gctgtacagttcagaacacctaaagccttagggtcagcaggaaaaggaagccgactacca
gacctgggatctgactacaaacctccaatgagtggcagcaacagccctcacgggagcccc
acctcccctctggacagcaacatgctgctggtcatcattgtctctgttggcgtcatcact
atcgtggtggttgtggtcattgctgtcttttgtacccggcgcaccacctctcaccagaag
aagaaacgagctgcgtgcaaatcagtgaatggctcccataagtacaagggcaattgcaaa
gatgtgaagcctccagacctatggatccatcacgagagactagagttgaagcctattgac
aagtctccagatcctaaccctgtcatgactgatactccaatccctcgaaactctcaagat
atcacaccagtggacaattccatggatagcaatatccatcaaaggcggaattcatacaga
gggcatgagtcagaggacagcatgtctacactggctggaaggaggggaatgagaccaaaa
atgatgatgccctttgactctcagccacctcagcctgtgattagtgcccatcccatccat
tccctcgataaccctcaccatcatttccactccagcagcctcgcttctccagcccgcagt
catctctaccacccaagcagcccatggcccattggcacatccatgtccctttcagacagg
gccaattccacagaatctgttcgaaatacccccagcacggacaccatgccagcgtcctcg
tctcagacgtgctgcactgaccatcaggaccctgagggtgctactagctcctcttacttg
gccagctcccaagaggaagactcaggccagagtcttcccacagcccatgtccgcccttcc
caccctctgaagagcttcgctgtgccagcaatcccacccccaggacctcctctctatgat
cctgcactgccaagcacaccattactgtcccagcaagctctgaaccatcacattcactca
gtgaaaacagcctccatcgggacgttaggaaggagccggcctcctatgccagtggttgtt
ccgagtgcccctgaagtacaggagaccaccaggatgctggaagactccgagagtagctat
gaaccagatgagctgaccaaagagatggcccacctggaaggactaatgaaggacctaaat
gccatcacaacagcctga

DBGET integrated database retrieval system