KEGG   Mus musculus (house mouse): 18030
Entry
18030             CDS       T01002                                 
Symbol
Nfil3, AV225605, E4BP4
Name
(RefSeq) nuclear factor, interleukin 3, regulated
  KO
K09059  nuclear factor, interleukin 3 regulated
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    18030 (Nfil3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18030 (Nfil3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   bZIP/PAR
    18030 (Nfil3)
SSDB
Motif
Pfam: Vert_IL3-reg_TF bZIP_2 bZIP_1 SDE2_2C
Other DBs
NCBI-GeneID: 18030
NCBI-ProteinID: NP_059069
MGI: 109495
Ensembl: ENSMUSG00000056749
UniProt: O08750
LinkDB
Position
13:complement(53121245..53136914)
AA seq 462 aa
MQLRKMQTIKKEPAPLDPTSSSDKMLLLNSALAEVAEDLASGEDLLLNEGSMGKNKSSAC
RRKREFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELL
SLKLKFGLISSTAYAQEIQKLSNSTAVYFQDYQTSKAAVSSFVDEHEPAMVAGSCISVIK
HSPQSSLSDVSEVSSVEHTQESPAQGGCRSPENKFPVIKQEPVELESFAREAREERGTYS
TSIYQSYMGSSFSTYSHSPPLLQVHGSTSNSPRTSEADEGVVGKSSDGEDEQQVPKGPIH
SPVELQRVHATVVKVPEVNPSALPHKLRIKAKAMQVKVEALDSEFEGMQKLSSPADAIAK
RHFDLEKHGTSGMAHSSLPPFSVQVTNIQDWSLKSEHWHHKELSSKTQSSFKTGVVEVKD
GGYKVSEAENLYLKQGIANLSAEVVSLKRFIATQPISASDSR
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgcagctgagaaaaatgcagaccatcaaaaaggagcccgcacccctagatcctaccagc
agctcagacaagatgctgctgctgaactctgccttagctgaggtggccgaggacctagcc
tcaggtgaagatttgctcctgaacgaagggagcatggggaaaaacaaatcctcggcgtgt
cggagaaaacgggaattcattccggacgagaagaaagacgccatgtattgggagaaacgg
cggaaaaacaacgaagctgccaaaagatctcgggagaagcgccgcctcaatgacctggtt
ttggagaacaagctgatcgccctgggagaagaaaatgccactttaaaagctgagctgctc
tccctgaaattaaagtttggtttaattagctccacggcgtatgcccaagaaatccagaaa
ctcagtaattccacagctgtctactttcaggactaccagacatccaaggctgccgtgagc
tcttttgtggacgagcatgagcctgcgatggtagccggaagttgcatctcagtcatcaag
cactctccccagagctcgctctccgatgtgtcagaggtgtcctcggtggagcacactcag
gaaagccccgcacagggaggctgccggagccctgagaacaagttccctgtgatcaagcag
gagcccgtggagttggagagctttgccagggaggccagggaggagcggggcacgtattcc
acctccatctaccagagctacatgggaagctctttctccacttactcccactccccaccc
ctcttgcaggtccatgggtccactagcaactccccaagaacctcagaggccgatgagggt
gtagtgggcaagtcttctgatggggaagacgaacaacaggtccctaagggccccatccat
tctccagtggagctgcaacgggtccacgccacggtggtgaaggttccggaagtgaaccct
tctgccttaccgcacaagcttcggattaaagccaaggccatgcaggtcaaagtggaggct
ttggacagcgagtttgaaggcatgcagaaactctcttcacccgccgatgcgatcgccaaa
agacattttgacctggagaaacatggaacctcgggtatggcccattcctccctccctcct
ttctcagtgcaggtgacgaacattcaagattggtccctcaaatcggaacactggcatcac
aaagaactgagcagcaaaactcagagtagcttcaaaacaggtgtggtggaagtcaaagac
ggtggctataaggtttccgaagctgagaatttgtatttgaagcagggaatagcaaactta
tctgcagaggtggtctcgctcaagagattcatagccacacaaccgatctcggcttcggac
tccaggtaa

DBGET integrated database retrieval system