KEGG   Mus musculus (house mouse): 18159
Entry
18159             CDS       T01002                                 
Symbol
Nppc, CNP, lbab
Name
(RefSeq) natriuretic peptide type C
  KO
K12336  natriuretic peptide C
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    18159 (Nppc)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    18159 (Nppc)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    18159 (Nppc)
SSDB
Motif
Pfam: ANP
Other DBs
NCBI-GeneID: 18159
NCBI-ProteinID: NP_035063
MGI: 97369
Ensembl: ENSMUSG00000026241
UniProt: Q61839 Q544K5
LinkDB
Position
1:complement(86594015..86598295)
AA seq 126 aa
MHLSQLIACALLLALLSLRPSEAKPGTPPKVPRTPPGEELADSQAAGGNQKKGDKTPGSG
GANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS
MSGLGC
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcacctctcccagctgatcgcctgcgccctgctgctcgcgctactctcgctccggccc
tctgaagccaagcccgggacaccaccgaaggtcccgagaaccccgccaggggaggagctg
gcggattcccaggcagctggtggcaatcagaaaaagggtgacaagactccaggcagcggg
ggagccaatctcaagggagaccgatcgcgactgctccgggacctgcgtgtggacaccaag
tcccgggctgcttgggcccgccttctgcacgagcaccccaacgcgcgcaaatacaaaggc
ggcaacaagaagggcttgtccaaaggctgctttggcctcaagctggaccggatcggctcc
atgagcggtctgggatgttag

DBGET integrated database retrieval system