KEGG   Mus musculus (house mouse): 18260
Entry
18260             CDS       T01002                                 
Symbol
Ocln, AI503564, Ocl
Name
(RefSeq) occludin
  KO
K06088  occludin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    18260 (Ocln)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    18260 (Ocln)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    18260 (Ocln)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    18260 (Ocln)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    18260 (Ocln)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     18260 (Ocln)
SSDB
Motif
Pfam: MARVEL Occludin_ELL HBM APG6_N GAS DUF4164 TMF_TATA_bd Laminin_II FapA Swi5 Anthrone_oxy
Other DBs
NCBI-GeneID: 18260
NCBI-ProteinID: NP_032782
MGI: 106183
Ensembl: ENSMUSG00000021638
UniProt: Q61146 B2RS24
LinkDB
Position
13:complement(100633012..100689226)
AA seq 521 aa
MSVRPFESPPPYRPDEFKPNHYAPSNDMYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTS
PPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTGLFGGSLNYPYSGFGYGGGYGGGYG
GYGYGYGGYTDPRAAKGFLLAMAAFCFIASLVIFVTSVIRSGMSRTRRYYLIVIIVSAIL
GIMVFIATIVYIMGVNPTAQASGSMYGSQIYMICNQFYTPGGTGLYVDQYLYHYCVVDPQ
EAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKNVS
AGTQDMPPPPSDYAERVDSPMAYSSNGKVNGKRSYPESFYKSTPLVPEVAQEIPLTLSVD
DFRQPRYSSNGNLETPSKRAPTKGKAGKGKRTDPDHYETDYTTGGESCEELEEDWVREYP
PITSDQQRQLYKRNFDAGLQEYKSLQAELDDVNKELSRLDKELDDYREESEEYMAAADEY
NRLKQVKGSADYKSKRNYCKQLKSKLSHIKRMVGDYDRRKP
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtccgtgaggccttttgaaagtccacctccttacagacctgatgaattcaaacccaat
cattatgcaccaagcaatgacatgtatggcggagagatgcatgtccggccgatgctctct
cagccagcgtactctttttatccggaagatgaaattcttcacttctacaaatggacgtcg
cccccaggggtgatccggatcctgtctatgctcattattgtgatgtgcatcgccatattt
gcctgtgtggcttccacacttgcttgggacagaggctatgggacagggctctttggagga
agcctaaactacccttatagtggctttggctacggaggtggctatggaggcggctatgga
ggctatggctatggctatggcggatatacagacccaagagcagccaaaggcttcctgttg
gccatggcagccttctgcttcatcgcttccttagtaatatttgtgaccagtgttataaga
tctggaatgtccaggacaagaagatattacttgatcgtgatcatagtcagcgctatcctg
ggcatcatggtgtttattgccacgatcgtgtacataatgggagtgaacccgacggcccag
gcttctggatctatgtacggctcacagatatatatgatctgcaaccagttttatactcct
ggaggtactggtctctacgtggatcaatatttgtatcactactgtgtggttgatccccag
gaggctatagccattgtcctggggttcatgattatcgtggcttttgctttaatcatcttt
tttgctgtgaaaacccgaagaaagatggatcggtatgataagtccaatattttgtgggat
aaggaacacatttatgatgaacagccccccaatgttgaagagtgggttaaaaatgtgtct
gcaggcacacaggacatgcctccacccccatctgactatgcggaaagagttgacagtcca
atggcctactcctccaatggcaaagtgaatggcaagcgatcatacccagagtctttctat
aagtcaacacctctggtgcctgaagtggcccaggagattcctctgaccttgagtgtggat
gacttcaggcagcctcggtacagcagcaatggtaacctagagacaccttctaaaagggct
cccacgaaggggaaagcaggaaagggcaagaggacggaccctgaccactatgaaacagac
tacacgacaggtggggagtcctgcgaggagctggaggaggactgggtcagggaatatcca
cctatcacttcagatcaacaaagacaactctacaagagaaattttgatgcaggtctgcag
gagtataagagcttacaggcagaactagacgacgtcaataaagagctctctcgtctagat
aaagagctggatgactacagagaggagagtgaagagtacatggctgctgctgatgaatat
aatagactaaagcaagttaagggatctgcagattataaaagtaagaggaattactgcaag
cagttgaagagcaaattatcgcacatcaagaggatggtgggagattatgacagacggaaa
ccttag

DBGET integrated database retrieval system