Mus musculus (house mouse): 18429 Help Entry 18429             CDS       T01002                                  Symbol Oxt, OT, Oxy Name (RefSeq) oxytocin   KO K05243   oxytocin-neurophysin 1 Organism mmu  Mus musculus (house mouse) Pathway mmu04024   cAMP signaling pathway mmu04080   Neuroactive ligand-receptor interaction mmu04081   Hormone signaling mmu04921   Oxytocin signaling pathway Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     18429 (Oxt)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     18429 (Oxt)    04081 Hormone signaling     18429 (Oxt)  09150 Organismal Systems   09152 Endocrine system    04921 Oxytocin signaling pathway     18429 (Oxt)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmu04052]     18429 (Oxt) Cytokines and neuropeptides [BR:mmu04052]  Neuropeptides   GPCR binding    18429 (Oxt) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_5 Hormone_4 Motif Other DBs NCBI-GeneID:  18429 NCBI-ProteinID:  NP_035155 MGI:  97453 Ensembl:  ENSMUSG00000027301 UniProt:  P35454 Q545V4 LinkDB All DBs Position 2:130416432..130418974 Genome browser AA seq 125 aa AA seqDB search MACPSLACCLLGLLALTSACYIQNCPLGGKRAVLDLDMRKCLPCGPGGKGRCFGPSICCA DELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAATGICCSPDGCRTDPACDPES AFSER NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggcctgccccagtctcgcttgctgcctgcttggcttactggctctgacctcggcctgc tacatccagaactgccccctgggcggcaagagggctgtgctggacctggatatgcgcaag tgtctcccctgcggcccgggcggcaaaggacgctgcttcggaccaagcatctgctgcgcg gacgagctgggctgcttcgtgggcaccgccgaggcgctgcgctgccaggaggagaactac ctgccttcgccctgccagtctggccagaagccctgcgggagcggaggccgctgcgccgcc acaggcatctgctgcagcccggatggctgccgcacagaccccgcctgcgaccctgagtct gccttctcggagcgctga

DBGET integrated database retrieval system