KEGG   Mus musculus (mouse): 18550Help
Entry
18550             CDS       T01002                                 

Gene name
Furin, 9130404I01Rik, Fur, PACE, Pcsk3, SPC1
Definition
(RefSeq) furin (paired basic amino acid cleaving enzyme)
  KO
K01349  furin [EC:3.4.21.75]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    18550 (Furin)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    18550 (Furin)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    18550 (Furin)
   04131 Membrane trafficking [BR:mmu04131]
    18550 (Furin)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.75  furin
     18550 (Furin)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S8: subtilisin family
   18550 (Furin)
Chaperones and folding catalysts [BR:mmu03110]
 Intramolecular chaperones
  Subtilisin family
   18550 (Furin)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Others
   Others
    18550 (Furin)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Furin-like_2 VSP DUF357
Motif
Other DBs
NCBI-GeneID: 18550
NCBI-ProteinID: NP_001074923
MGI: 97513
Ensembl: ENSMUSG00000030530
Vega: OTTMUSG00000028566
UniProt: P23188
LinkDB All DBs
Structure
PDB: 

Position
7 D2; 7 45.65 cM
AA seq 793 aa AA seqDB search
MELRSWLLWVVAAAGAVVLLAADAQGQKIFTNTWAVHIPGGPAVADRVAQKHGFHNLGQI
FGDYYHFWHRAVTKRSLSPHRPRHSRLQREPQVKWLEQQVAKRRAKRDVYQEPTDPKFPQ
QWYLSGVTQRDLNVKEAWAQGFTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDP
DPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSL
GLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREH
DSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKC
TESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNADDWATNGVGRKV
SHSYGYGLLDAGAMVALAQNWTTVAPQRKCIVEILVEPKDIGKRLEVRKAVTACLGEPNH
ITRLEHVQARLTLSYNRRGDLAIHLISPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWD
EDPAGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLSTPPESSGCKTLTSSQACVVCE
EGYSLHQKSCVQHCPPGFIPQVLDTHYSTENDVEIIRASVCTPCHASCATCQGPAPTDCL
SCPSHASLDPVEQTCSRQSQSSRESRPQQQPPALRPEVEMEPRLQAGLASHLPEVLAGLS
CLIIVLIFGIVFLFLHRCSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEEDEGR
GERTAFIKDQSAL
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atggagctgagatcctggttgctatgggtggtcgcagcagcaggagccgtggtcctgctg
gcagctgatgctcaaggccagaagatcttcaccaacacctgggccgtgcacattcctgga
ggcccagctgtggctgatagggtggcgcagaagcatggcttccacaacctgggccagatc
ttcggtgactattaccacttctggcacagagcagtgacaaagcggtccctgtcgcctcac
cgcccgcggcacagccggctacagagggagcctcaagtaaagtggctggagcagcaggta
gccaagcgaagagccaagagggacgtgtatcaggagcccacggaccccaagttcccccag
cagtggtacctgtctggtgtcactcagcgagacctgaatgtgaaggaggcctgggcccag
ggcttcacaggccatggcattgtggtctccatcctggatgacggcattgagaagaatcat
cccgacctagcaggcaattatgaccctggagccagttttgacgtgaatgaccaggacccc
gacccacagcctcggtacacacagatgaatgacaacaggcatggcactcgctgtgccggg
gaagtggcagcagtggccaacaatggtgtctgtggcgtaggtgtagcttacaatgcccga
attggaggggtgcggatgttggatggcgaggtgactgatgcagtagaggcacgttcgctg
ggcctgaatcccaaccacatccacatctacagcgccagctggggccctgaggacgacggc
aagaccgtggatggaccagcccggctcgctgaggaggccttctttcggggagttagccag
ggccgaggagggctgggctccatctttgtctgggcctcagggaatgggggccgggaacat
gacagctgcaactgtgacggctacaccaacagcatctatacactgtccatcagcagcgcc
acacagttcggcaatgtgccctggtacagtgaggcctgctcctccacactggccaccacc
tacagcagcggcaaccagaatgagaagcagatcgtgacaactgacctgaggcagaagtgc
acagaatctcacacaggcacctcggcttctgcccccttggcagctggtatcattgctctc
accctggaggccaacaagaacctcacctggcgggacatgcagcacctggtagtgcagacc
tcaaagccagcccacctcaacgctgatgattgggctaccaacggcgtgggccggaaagtg
agccattcgtatggctacgggctgttggatgcaggtgccatggtggctctggcccagaac
tggacaacagtggccccccagcggaagtgcattgttgaaatcctggtggaacccaaggac
atcggcaaacggctagaggtgcgcaaggcggtgacagcatgcctgggtgagcccaaccac
atcaccaggctggaacacgttcaggcccggctcaccctgtcttacaatcgccgcggtgac
ctggctatccacctcatcagccccatgggcacccgctccaccctgttagctgccagacca
catgactactctgctgatgggtttaatgattgggctttcatgacaacccattcctgggat
gaggatccggctggcgaatgggtcctagagattgaaaataccagtgaagccaacaactat
gggacgctgaccaagttcactctcgttctgtatggcacagcccccgaggggctctctaca
cctccagaaagcagcggctgcaagaccctcacatccagccaggcctgcgtggtgtgtgag
gaaggttactctctgcaccagaaaagctgtgtccagcactgcccaccaggcttcatcccc
caagtccttgatacacactacagcactgagaatgatgtggagatcatccgtgccagcgtc
tgtaccccctgccacgcctcatgtgccacttgccagggcccggcccccacagactgcctc
agctgccccagccatgcctccctggacccagtggagcagacctgctcccggcaaagccag
agcagccgggagtctcggcctcagcagcagcctcctgcactgcgccctgaggtggagatg
gagccccggctgcaggctgggttggcctctcacctgcccgaggtcctggccggcctcagc
tgccttatcatcgtgctcatctttggcatcgtcttcctgttcctgcatcggtgttcgggc
ttcagcttccggggagtgaaagtgtacaccatggaccgcggcctcatctcctacaagggg
ctgccccctgaagcctggcaggaggagtgcccatcggactcagaggaggacgagggccgg
ggcgagaggaccgccttcatcaaagaccagagcgccctttga

DBGET integrated database retrieval system