Mus musculus (house mouse): 18643 Help Entry 18643             CDS       T01002                                  Symbol Pfn1, Pfn Name (RefSeq) profilin 1   KO K05759   profilin Organism mmu  Mus musculus (house mouse) Pathway mmu04015   Rap1 signaling pathway mmu04810   Regulation of actin cytoskeleton mmu05014   Amyotrophic lateral sclerosis mmu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     18643 (Pfn1)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     18643 (Pfn1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmu04131]     18643 (Pfn1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mmu04812]     18643 (Pfn1)    04147 Exosome [BR:mmu04147]     18643 (Pfn1) Membrane trafficking [BR:mmu04131]  Others   Actin-binding proteins    Others     18643 (Pfn1) Cytoskeleton proteins [BR:mmu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      18643 (Pfn1) Exosome [BR:mmu04147]  Exosomal proteins   Proteins found in most exosomes    18643 (Pfn1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  18643 NCBI-ProteinID:  NP_035202 MGI:  97549 Ensembl:  ENSMUSG00000018293 UniProt:  P62962 Q5SX50 Q3U7V7 LinkDB All DBs Position 11:complement(70542670..70547625) Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDSLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVSITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVH GGLINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacagccttatggcggacgggacctgtcaggacgcg gccatcgtaggctacaaggactcgccctccgtctgggccgccgtccccgggaagaccttc gttagcattacgccagctgaggttggtgtcctggtaggcaaagaccggtcaagttttttc gtcaatgggctgacacttgggggccagaaatgttctgtgatccgggactcactgctgcaa gacggggaatttacaatggatcttcgtaccaagagcaccggaggagcccccaccttcaat gtcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtttgatcaacaagaaatgttatgaaatggcctctcacctgcggcgttcccagtac tga

DBGET integrated database retrieval system