Mus musculus (house mouse): 18645 Help Entry 18645             CDS       T01002                                  Symbol Pfn2, Pfn Name (RefSeq) profilin 2   KO K05759   profilin Organism mmu  Mus musculus (house mouse) Pathway mmu04015   Rap1 signaling pathway mmu04810   Regulation of actin cytoskeleton mmu05014   Amyotrophic lateral sclerosis mmu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     18645 (Pfn2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     18645 (Pfn2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     18645 (Pfn2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     18645 (Pfn2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmu04131]     18645 (Pfn2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mmu04812]     18645 (Pfn2)    04147 Exosome [BR:mmu04147]     18645 (Pfn2) Membrane trafficking [BR:mmu04131]  Others   Actin-binding proteins    Others     18645 (Pfn2) Cytoskeleton proteins [BR:mmu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      18645 (Pfn2) Exosome [BR:mmu04147]  Exosomal proteins   Proteins found in most exosomes    18645 (Pfn2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  18645 NCBI-ProteinID:  NP_062283 MGI:  97550 Ensembl:  ENSMUSG00000027805 UniProt:  Q9JJV2 Structure PDBPDBj LinkDB All DBs Position 3:complement(57749316..57755178) Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcatcacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggagcaaagaagtgttctgtgatcagagatagcctatacgtt gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgctgttggcagggccgggagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system