KEGG   Mus musculus (house mouse): 19274
Entry
19274             CDS       T01002                                 
Symbol
Ptprm, RPTPmu, mKIAA4044
Name
(RefSeq) protein tyrosine phosphatase, receptor type, M
  KO
K05693  receptor-type tyrosine-protein phosphatase mu [EC:3.1.3.48]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    19274 (Ptprm)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    19274 (Ptprm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19274 (Ptprm)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     19274 (Ptprm)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    19274 (Ptprm)
SSDB
Motif
Pfam: Y_phosphatase MAM fn3 ig DSPc Y_phosphatase3 PTP_tm I-set Ig_3 PTPlike_phytase ECSCR Pur_ac_phosph_N EphA2_TM Ig_2 DctM DUF948 DUF6377
Other DBs
NCBI-GeneID: 19274
NCBI-ProteinID: NP_033010
MGI: 102694
Ensembl: ENSMUSG00000033278
UniProt: P28828 Q68FM4
LinkDB
Position
17:complement(66973843..67661486)
AA seq 1452 aa
MRTLGTCLVTLAGLLLTAAGETFSGGCLFDEPYSTCGYSQADEDDFNWEQVNTLTKPTSD
PWMPSGSFMLVNTSGKPEGQRAHLLLPQLKENDTHCIDFHYFVSSKSNAAPGLLNVYVKV
NNGPLGNPIWNISGDPTRTWHRAELAISTFWPNFYQVIFEVVTSGHQGYLAIDEVKVLGH
PCTRTPHFLRIQNVEVNAGQFATFQCSAIGRTVAGDRLWLQGIDVRDAPLKEIKVTSSRR
FIASFNVVNTTKRDAGKYRCMICTEGGVGISNYAELVVKEPPVPIAPPQLASVGATYLWI
QLNANSINGDGPIVAREVEYCTASGSWNDRQPVDSTSYKIGHLDPDTEYEISVLLTRPGE
GGTGSPGPALRTRTKCADPMRGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYG
YQVGGQEQVREEVSWDTDNSHPQHTITNLSPYTNVSVKLILMNPEGRKESQELTVQTDED
LPGAVPTESIQGSAFEEKIFLQWREPTQTYGVITLYEITYKAVSSFDPEIDLSNQSGRVS
KLGNETHFLFFGLYPGTTYSFTIRASTAKGFGPPATNQFTTKISAPSMPAYEFETPLNQT
DNTVTVMLKPAQSRGAPVSVYQIVVEEERPRRTKKTTEILKCYPVPIHFQNASILNSQYY
FAAEFPADSLQAAQPFTIGDNKTYNGYWNTPLLPHKSYRIYYQAASRANGETKIDCVRVA
TKGAVTPKPVPEPEKQTDHTVKIAGVIAGILLFVIIFLGVVLVMKKRKLAKKRKETMSST
RQEMTVMVNSMDKSYAEQGTNCDEAFSFMGTHNLNGRSVSSPSSFTMKTNTLSTSVPNSY
YPDETHTMASDTSSLAQPHTYKKREAADVPYQTGQLHPAIRVADLLQHITQMKCAEGYGF
KEEYESFFEGQSAPWDSAKKDENRMKNRYGNIIAYDHSRVRLQMLEGDNNSDYINGNYID
GYHRPNHYIATQGPMQETIYDFWRMVWHENTASIIMVTNLVEVGRVKCCKYWPDDTEIYK
DIKVTLIDTELLAEYVIRTFAVEKRGIHEIREIRQFHFTGWPDHGVPYHATGLLGFVRQV
KSKSPPNAGPLVVHCSAGAGRTGCFIVIDIMLDMAEREGVVDIYNCVRELRSRRVNMVQT
EEQYVFIHDAILEACLCGDTSIPASQVRSLYYDMNKLDPQTNSSQIKEEFRTLNMVTPTL
RVEDCSIALLPRNHEKNRCMDILPPDRCLPFLITIDGESSNYINAALMDSYKQPSAFIVT
QHPLPNTVKDFWRLVLDYHCTSVVMLNDVDPAQLCPQYWPENGVHRHGPIQVEFVSADLE
EDIISRIFRIYNASRPQDGHRMVQQFQFLGWPMYRDTPVSKRSFLKLIRQVDKWQEEYNG
GEGRTVVHCLNGGGRSGTFCAISIVCEMLRHQRTVDVFHAVKTLRNNKPNMVDLLDQYKF
CYEVALEYLNSG
NT seq 4359 nt   +upstreamnt  +downstreamnt
atgaggacacttgggacttgcctggtgactttagctggacttttgctaactgcggccgga
gaaacattttcaggtggctgcctctttgatgaaccatacagcacatgtggatatagtcaa
gctgacgaagatgacttcaactgggagcaggtgaacaccctgaccaaaccgacctctgac
ccctggatgccatcaggctccttcatgctggtcaacacttctgggaaaccagaaggccag
agagctcacctgctcctgcctcagcttaaggaaaatgacacccactgcatcgactttcac
tactttgtatccagcaagagtaacgctgctcctgggttgctcaatgtctatgtgaaggtg
aataatggaccactggggaatcccatctggaacatatccggagaccccacccgcacgtgg
cacagggcagagctggccatcagcacgttctggcccaacttttaccaggtgatttttgaa
gtggtgacctctggccatcaaggctaccttgctatcgatgaagttaaggtcttaggacac
ccgtgcacaagaactccccacttcctgcggattcagaacgtggaggtgaatgccggccag
tttgctaccttccagtgcagcgccataggcaggacagtggctggggaccggctctggctg
cagggaattgatgtccgagatgcccctctgaaggagataaaggtgactagttccagaaga
ttcatagcctcatttaacgttgtaaacacgaccaagagagacgctgggaagtaccgctgc
atgatttgcacggaaggaggtgtcgggatatcaaactacgcagaattggtagttaaagag
ccacctgttcccatcgccccacctcagctcgcctctgtcggagcaacctatctgtggata
cagctcaatgccaactccatcaatggggacggacccattgtggcccgcgaggttgagtac
tgcacagccagcgggagctggaatgatcggcagccagtggattccacgagttacaagatt
gggcaccttgacccagacacagagtatgagatcagtgtgcttcttaccagaccaggagaa
ggcggcactgggtctcccgggccagctctgagaacaaggacaaagtgtgccgatcccatg
cgtggcccgagaaaactagaagttgtggaggtcaaatctcgacaaatcaccatccgctgg
gagccgtttggatacaatgtaactcgttgccacagttataatctcacagtgcactatggt
taccaggtcggagggcaggagcaggtgcgagaagaagtgagctgggatacagataactcc
caccctcagcacaccatcaccaacctgtccccgtacaccaacgtcagcgtgaagcttatt
ctgatgaacccggagggccgcaaggaaagccaagaactcacggtgcagacggatgaagac
ctcccaggagctgtccccactgaatccatccaaggcagtgcctttgaagagaagatattt
cttcagtggagagagccgacacaaacatatggggtcatcactttatatgagatcacctac
aaagcagtcagttcctttgacccggaaatagatttatccaaccaaagtgggcgagtttca
aaactgggaaatgaaacccattttctgttctttggcctgtatcctggaacgacgtactcc
ttcaccatcagagccagcacagcgaaggggttcggacctccggcaacaaaccagttcacc
acaaaaatatcagcaccatccatgccagcctatgaatttgagacacctttgaatcagact
gataatacagtgactgtgatgctgaaacctgcacaaagcagaggggctccagtcagtgtc
tatcaaatcgttgttgaggaagaacgtcctcggagaactaagaagacaacagagatcttg
aagtgttacccggtgccaattcacttccagaatgcgtccatcctgaactcacagtactac
tttgctgcagaatttcctgcagacagcctccaagctgctcaaccatttaccattggtgac
aataagacatacaatggctactggaacacccccctcctcccccataaaagctacagaatt
tattaccaagctgctagtcgagccaatggggaaaccaaaattgactgtgtccgagtggcc
acaaaaggggccgttactccaaagcctgtccctgaacctgagaaacaaacagaccacacg
gttaaaatcgccggagtgattgcaggcatcttgctgtttgttatcatatttcttggagtc
gtgctggtcatgaagaagaggaaactggccaagaagaggaaggagacgatgagcagcacc
cggcaggagatgacagtgatggtgaattctatggataagagctatgctgagcaaggcacc
aactgcgacgaagccttctctttcatgggcacgcacaatcttaatgggagatctgtgtcc
tcgccatcatcctttaccatgaaaacaaacacgctgagcacatcggtgccgaattcctat
tacccagatgagacccacacaatggccagtgacaccagcagcctggcacagccccatact
tataagaaacgcgaggccgcagacgtgccttaccagactgggcagcttcacccggccatc
cgtgtggcagacctcctccaacacatcactcagatgaagtgcgctgagggctatggcttc
aaggaggagtatgagagcttctttgaaggacagtctgcaccatgggactctgctaagaaa
gacgagaacagaatgaagaacagatacgggaacatcattgcatatgatcactctcgggta
cggctccagatgctggaaggggacaacaattcagactacatcaatggcaattacatcgat
ggctatcatcgacccaatcattatattgcaacccaaggacccatgcaggagactatctat
gacttctggaggatggtgtggcatgagaacacggcaagcatcatcatggtgaccaacctt
gtggaagtgggaagggtgaaatgctgtaaatactggccagatgacaccgagatctacaaa
gacattaaagtcaccctaatagatacagagctgctggcagaatatgtgataagaacgttt
gccgtggaaaagagaggcattcatgaaatccgagagatcagacagtttcacttcaccggc
tggccggaccacggcgtcccctaccatgccactggcctgctgggatttgtccggcaggtc
aaatccaagagcccacccaatgcaggcccgctggtggtacactgcagtgctggagcagga
aggacaggttgcttcattgtcattgatatcatgctggacatggcagaaagggaaggagtg
gtggacatctacaactgtgtcagagagcttcggtccaggagagtcaacatggtgcagaca
gaggagcagtacgtctttatccatgatgcgatcctggaagcctgtctttgtggagacacc
tccatccctgcctcccaagtcaggtctctctactatgacatgaacaaactggacccacag
acaaactcaagccaaattaaagaggaattccggactctcaacatggtgacccccacgctg
cgtgtggaggactgcagcatcgcactcctaccccggaaccacgagaaaaatcgctgcatg
gacatcctgcctccggaccgctgcctgcccttcctcatcaccatcgatggagagagcagc
aactacatcaatgcagccctaatggacagctataaacagccttcagcatttatagtcacc
cagcatcctttgccaaacaccgtcaaagacttctggcgactggtcttggattaccactgc
acatccgtagttatgctgaacgatgtggatcctgcccagctgtgtccacagtactggcca
gaaaatggagtgcacagacatggccccatccaggtggaattcgtgtctgcagacttagaa
gaagacatcatcagcagaattttcaggatttacaacgcctccagaccccaggatggacat
cggatggttcagcagttccagttcctgggctggccgatgtacagggacacgcccgtgtcc
aagcgctccttcttgaagctcatacgccaggtggacaagtggcaggaggaatacaatggc
ggcgaaggccgcacagtcgtgcactgcttgaacggaggaggccgcagtggtacattctgt
gccatcagcattgtctgtgagatgctccgacaccagagaactgtggatgtcttccatgct
gtcaagacattgaggaacaacaaaccaaacatggtggacctcctggatcagtacaagttc
tgctatgaggtggccctggagtacctgaattcgggctga

DBGET integrated database retrieval system