Mus musculus (house mouse): 19353 Help Entry 19353             CDS       T01002                                  Symbol Rac1, D5Ertd559e Name (RefSeq) Rac family small GTPase 1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism mmu  Mus musculus (house mouse) Pathway mmu04010   MAPK signaling pathway mmu04014   Ras signaling pathway mmu04015   Rap1 signaling pathway mmu04024   cAMP signaling pathway mmu04062   Chemokine signaling pathway mmu04071   Sphingolipid signaling pathway mmu04145   Phagosome mmu04148   Efferocytosis mmu04151   PI3K-Akt signaling pathway mmu04310   Wnt signaling pathway mmu04360   Axon guidance mmu04370   VEGF signaling pathway mmu04380   Osteoclast differentiation mmu04510   Focal adhesion mmu04520   Adherens junction mmu04530   Tight junction mmu04613   Neutrophil extracellular trap formation mmu04620   Toll-like receptor signaling pathway mmu04650   Natural killer cell mediated cytotoxicity mmu04662   B cell receptor signaling pathway mmu04664   Fc epsilon RI signaling pathway mmu04666   Fc gamma R-mediated phagocytosis mmu04670   Leukocyte transendothelial migration mmu04722   Neurotrophin signaling pathway mmu04810   Regulation of actin cytoskeleton mmu04932   Non-alcoholic fatty liver disease mmu04933   AGE-RAGE signaling pathway in diabetic complications mmu04972   Pancreatic secretion mmu05014   Amyotrophic lateral sclerosis mmu05020   Prion disease mmu05022   Pathways of neurodegeneration - multiple diseases mmu05100   Bacterial invasion of epithelial cells mmu05132   Salmonella infection mmu05135   Yersinia infection mmu05163   Human cytomegalovirus infection mmu05167   Kaposi sarcoma-associated herpesvirus infection mmu05169   Epstein-Barr virus infection mmu05170   Human immunodeficiency virus 1 infection mmu05200   Pathways in cancer mmu05203   Viral carcinogenesis mmu05205   Proteoglycans in cancer mmu05208   Chemical carcinogenesis - reactive oxygen species mmu05210   Colorectal cancer mmu05211   Renal cell carcinoma mmu05212   Pancreatic cancer mmu05231   Choline metabolism in cancer mmu05415   Diabetic cardiomyopathy mmu05416   Viral myocarditis mmu05417   Lipid and atherosclerosis mmu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     19353 (Rac1)    04014 Ras signaling pathway     19353 (Rac1)    04015 Rap1 signaling pathway     19353 (Rac1)    04310 Wnt signaling pathway     19353 (Rac1)    04370 VEGF signaling pathway     19353 (Rac1)    04071 Sphingolipid signaling pathway     19353 (Rac1)    04024 cAMP signaling pathway     19353 (Rac1)    04151 PI3K-Akt signaling pathway     19353 (Rac1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     19353 (Rac1)    04148 Efferocytosis     19353 (Rac1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     19353 (Rac1)    04520 Adherens junction     19353 (Rac1)    04530 Tight junction     19353 (Rac1)   09142 Cell motility    04810 Regulation of actin cytoskeleton     19353 (Rac1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     19353 (Rac1)    04620 Toll-like receptor signaling pathway     19353 (Rac1)    04650 Natural killer cell mediated cytotoxicity     19353 (Rac1)    04662 B cell receptor signaling pathway     19353 (Rac1)    04664 Fc epsilon RI signaling pathway     19353 (Rac1)    04666 Fc gamma R-mediated phagocytosis     19353 (Rac1)    04670 Leukocyte transendothelial migration     19353 (Rac1)    04062 Chemokine signaling pathway     19353 (Rac1)   09154 Digestive system    04972 Pancreatic secretion     19353 (Rac1)   09156 Nervous system    04722 Neurotrophin signaling pathway     19353 (Rac1)   09158 Development and regeneration    04360 Axon guidance     19353 (Rac1)    04380 Osteoclast differentiation     19353 (Rac1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     19353 (Rac1)    05205 Proteoglycans in cancer     19353 (Rac1)    05208 Chemical carcinogenesis - reactive oxygen species     19353 (Rac1)    05203 Viral carcinogenesis     19353 (Rac1)    05231 Choline metabolism in cancer     19353 (Rac1)   09162 Cancer: specific types    05210 Colorectal cancer     19353 (Rac1)    05212 Pancreatic cancer     19353 (Rac1)    05211 Renal cell carcinoma     19353 (Rac1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     19353 (Rac1)    05163 Human cytomegalovirus infection     19353 (Rac1)    05167 Kaposi sarcoma-associated herpesvirus infection     19353 (Rac1)    05169 Epstein-Barr virus infection     19353 (Rac1)   09171 Infectious disease: bacterial    05132 Salmonella infection     19353 (Rac1)    05135 Yersinia infection     19353 (Rac1)    05100 Bacterial invasion of epithelial cells     19353 (Rac1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     19353 (Rac1)    05020 Prion disease     19353 (Rac1)    05022 Pathways of neurodegeneration - multiple diseases     19353 (Rac1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     19353 (Rac1)    05418 Fluid shear stress and atherosclerosis     19353 (Rac1)    05415 Diabetic cardiomyopathy     19353 (Rac1)    05416 Viral myocarditis     19353 (Rac1)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     19353 (Rac1)    04933 AGE-RAGE signaling pathway in diabetic complications     19353 (Rac1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmu04131]     19353 (Rac1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     19353 (Rac1)    04031 GTP-binding proteins [BR:mmu04031]     19353 (Rac1) Membrane trafficking [BR:mmu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     19353 (Rac1)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     19353 (Rac1)   Macropinocytosis    Ras GTPases     19353 (Rac1)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     19353 (Rac1) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    19353 (Rac1)   Exosomal proteins of other body fluids (saliva and urine)    19353 (Rac1)   Exosomal proteins of colorectal cancer cells    19353 (Rac1)   Exosomal proteins of bladder cancer cells    19353 (Rac1) GTP-binding proteins [BR:mmu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     19353 (Rac1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  19353 NCBI-ProteinID:  NP_033033 MGI:  97845 Ensembl:  ENSMUSG00000001847 UniProt:  P63001 K7Q7T7 LinkDB All DBs Position 5:complement(143491236..143513786) Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP PVKKRKRKCLLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggccatcaagtgtgtggtggtgggagacggagctgttggtaaaacctgcctgctc atcagttacacgaccaatgcatttcctggagagtacatccccaccgtctttgacaactat tctgccaatgttatggtagatggaaaaccagtgaatctgggcctatgggacacagctgga caagaagattatgacagattgcgtcccctctcctacccgcagacagacgtgttcttaatt tgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgaa gtgcgacaccactgtcccaatactcctatcatcctcgtggggacgaagcttgatcttagg gatgataaggacaccattgagaagctgaaggagaagaagctgactcccatcacctacccg caggggctggccatggcgaaagagatcggtgctgtcaaatacctggagtgctcagctctc acacagcgaggactcaagacagtgtttgacgaagctatccgagcggttctctgtccccct cctgtcaagaagaggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system