KEGG   Mus musculus (house mouse): 19353
Entry
19353             CDS       T01002                                 
Symbol
Rac1, D5Ertd559e
Name
(RefSeq) Rac family small GTPase 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04145  Phagosome
mmu04148  Efferocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04530  Tight junction
mmu04613  Neutrophil extracellular trap formation
mmu04620  Toll-like receptor signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04670  Leukocyte transendothelial migration
mmu04722  Neurotrophin signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu04932  Non-alcoholic fatty liver disease
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04972  Pancreatic secretion
mmu05014  Amyotrophic lateral sclerosis
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05100  Bacterial invasion of epithelial cells
mmu05132  Salmonella infection
mmu05135  Yersinia infection
mmu05163  Human cytomegalovirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05231  Choline metabolism in cancer
mmu05415  Diabetic cardiomyopathy
mmu05416  Viral myocarditis
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    19353 (Rac1)
   04014 Ras signaling pathway
    19353 (Rac1)
   04015 Rap1 signaling pathway
    19353 (Rac1)
   04310 Wnt signaling pathway
    19353 (Rac1)
   04370 VEGF signaling pathway
    19353 (Rac1)
   04071 Sphingolipid signaling pathway
    19353 (Rac1)
   04024 cAMP signaling pathway
    19353 (Rac1)
   04151 PI3K-Akt signaling pathway
    19353 (Rac1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    19353 (Rac1)
   04148 Efferocytosis
    19353 (Rac1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    19353 (Rac1)
   04520 Adherens junction
    19353 (Rac1)
   04530 Tight junction
    19353 (Rac1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    19353 (Rac1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    19353 (Rac1)
   04620 Toll-like receptor signaling pathway
    19353 (Rac1)
   04650 Natural killer cell mediated cytotoxicity
    19353 (Rac1)
   04662 B cell receptor signaling pathway
    19353 (Rac1)
   04664 Fc epsilon RI signaling pathway
    19353 (Rac1)
   04666 Fc gamma R-mediated phagocytosis
    19353 (Rac1)
   04670 Leukocyte transendothelial migration
    19353 (Rac1)
   04062 Chemokine signaling pathway
    19353 (Rac1)
  09154 Digestive system
   04972 Pancreatic secretion
    19353 (Rac1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    19353 (Rac1)
  09158 Development and regeneration
   04360 Axon guidance
    19353 (Rac1)
   04380 Osteoclast differentiation
    19353 (Rac1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19353 (Rac1)
   05205 Proteoglycans in cancer
    19353 (Rac1)
   05208 Chemical carcinogenesis - reactive oxygen species
    19353 (Rac1)
   05203 Viral carcinogenesis
    19353 (Rac1)
   05231 Choline metabolism in cancer
    19353 (Rac1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    19353 (Rac1)
   05212 Pancreatic cancer
    19353 (Rac1)
   05211 Renal cell carcinoma
    19353 (Rac1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    19353 (Rac1)
   05163 Human cytomegalovirus infection
    19353 (Rac1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    19353 (Rac1)
   05169 Epstein-Barr virus infection
    19353 (Rac1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    19353 (Rac1)
   05135 Yersinia infection
    19353 (Rac1)
   05100 Bacterial invasion of epithelial cells
    19353 (Rac1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    19353 (Rac1)
   05020 Prion disease
    19353 (Rac1)
   05022 Pathways of neurodegeneration - multiple diseases
    19353 (Rac1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    19353 (Rac1)
   05418 Fluid shear stress and atherosclerosis
    19353 (Rac1)
   05415 Diabetic cardiomyopathy
    19353 (Rac1)
   05416 Viral myocarditis
    19353 (Rac1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    19353 (Rac1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    19353 (Rac1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19353 (Rac1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    19353 (Rac1)
   04031 GTP-binding proteins [BR:mmu04031]
    19353 (Rac1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    19353 (Rac1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    19353 (Rac1)
  Macropinocytosis
   Ras GTPases
    19353 (Rac1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    19353 (Rac1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   19353 (Rac1)
  Exosomal proteins of other body fluids (saliva and urine)
   19353 (Rac1)
  Exosomal proteins of colorectal cancer cells
   19353 (Rac1)
  Exosomal proteins of bladder cancer cells
   19353 (Rac1)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    19353 (Rac1)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Other DBs
NCBI-GeneID: 19353
NCBI-ProteinID: NP_033033
MGI: 97845
Ensembl: ENSMUSG00000001847
UniProt: P63001 K7Q7T7
LinkDB
Position
5:complement(143491236..143513786)
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgttggtaaaacctgcctgctc
atcagttacacgaccaatgcatttcctggagagtacatccccaccgtctttgacaactat
tctgccaatgttatggtagatggaaaaccagtgaatctgggcctatgggacacagctgga
caagaagattatgacagattgcgtcccctctcctacccgcagacagacgtgttcttaatt
tgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgaa
gtgcgacaccactgtcccaatactcctatcatcctcgtggggacgaagcttgatcttagg
gatgataaggacaccattgagaagctgaaggagaagaagctgactcccatcacctacccg
caggggctggccatggcgaaagagatcggtgctgtcaaatacctggagtgctcagctctc
acacagcgaggactcaagacagtgtttgacgaagctatccgagcggttctctgtccccct
cctgtcaagaagaggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system