Mus musculus (house mouse): 19354 Help Entry 19354             CDS       T01002                                  Symbol Rac2 Name (RefSeq) Rac family small GTPase 2   KO K07860   Ras-related C3 botulinum toxin substrate 2 Organism mmu  Mus musculus (house mouse) Pathway mmu04010   MAPK signaling pathway mmu04014   Ras signaling pathway mmu04015   Rap1 signaling pathway mmu04024   cAMP signaling pathway mmu04062   Chemokine signaling pathway mmu04071   Sphingolipid signaling pathway mmu04310   Wnt signaling pathway mmu04360   Axon guidance mmu04370   VEGF signaling pathway mmu04510   Focal adhesion mmu04520   Adherens junction mmu04613   Neutrophil extracellular trap formation mmu04650   Natural killer cell mediated cytotoxicity mmu04662   B cell receptor signaling pathway mmu04664   Fc epsilon RI signaling pathway mmu04666   Fc gamma R-mediated phagocytosis mmu04670   Leukocyte transendothelial migration mmu04810   Regulation of actin cytoskeleton mmu05020   Prion disease mmu05135   Yersinia infection mmu05163   Human cytomegalovirus infection mmu05170   Human immunodeficiency virus 1 infection mmu05200   Pathways in cancer mmu05210   Colorectal cancer mmu05212   Pancreatic cancer mmu05231   Choline metabolism in cancer mmu05415   Diabetic cardiomyopathy mmu05416   Viral myocarditis mmu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     19354 (Rac2)    04014 Ras signaling pathway     19354 (Rac2)    04015 Rap1 signaling pathway     19354 (Rac2)    04310 Wnt signaling pathway     19354 (Rac2)    04370 VEGF signaling pathway     19354 (Rac2)    04071 Sphingolipid signaling pathway     19354 (Rac2)    04024 cAMP signaling pathway     19354 (Rac2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     19354 (Rac2)    04520 Adherens junction     19354 (Rac2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     19354 (Rac2)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     19354 (Rac2)    04650 Natural killer cell mediated cytotoxicity     19354 (Rac2)    04662 B cell receptor signaling pathway     19354 (Rac2)    04664 Fc epsilon RI signaling pathway     19354 (Rac2)    04666 Fc gamma R-mediated phagocytosis     19354 (Rac2)    04670 Leukocyte transendothelial migration     19354 (Rac2)    04062 Chemokine signaling pathway     19354 (Rac2)   09158 Development and regeneration    04360 Axon guidance     19354 (Rac2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     19354 (Rac2)    05231 Choline metabolism in cancer     19354 (Rac2)   09162 Cancer: specific types    05210 Colorectal cancer     19354 (Rac2)    05212 Pancreatic cancer     19354 (Rac2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     19354 (Rac2)    05163 Human cytomegalovirus infection     19354 (Rac2)   09171 Infectious disease: bacterial    05135 Yersinia infection     19354 (Rac2)   09164 Neurodegenerative disease    05020 Prion disease     19354 (Rac2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     19354 (Rac2)    05415 Diabetic cardiomyopathy     19354 (Rac2)    05416 Viral myocarditis     19354 (Rac2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mmu04031]     19354 (Rac2) GTP-binding proteins [BR:mmu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     19354 (Rac2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  19354 NCBI-ProteinID:  NP_033034 MGI:  97846 Ensembl:  ENSMUSG00000033220 UniProt:  Q05144 LinkDB All DBs Position 15:complement(78443369..78456983) Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR DDKDTIEKLKEKKLAPITYPQGLALAKDIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ PTRQQKRPCSLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggccatcaagtgtgtggtggtgggtgatggagccgtgggcaagacgtgtcttctc atcagctacaccaccaacgccttccctggagaatacatccccactgtatttgacaactac tcagccaatgtgatggtggacagtaagccggtgaacctggggctgtgggataccgcaggt caggaggactatgaccgcctccggccactctcctacccacagacagatgtatttctcatc tgcttctcgctagtcagcccagcctcctatgagaatgtccgtgccaagtggttccctgag gtacggcaccactgccccagcacccccatcatcctggtgggtaccaagctggaccttcgc gatgacaaggacaccatcgagaagctgaaggagaagaagctggctcccatcacctacccg cagggcctggcactggccaaggatattgattcagtcaagtacttggaatgttctgcactc acccagcgaggcctgaagaccgtcttcgatgaggcaatccgcgcagtcctctgcccacag cccacacgacagcagaagcgcccctgcagcctgctctag

DBGET integrated database retrieval system