KEGG   Mus musculus (mouse): 19699Help
Entry
19699             CDS       T01002                                 

Gene name
Reln, reeler, rl
Definition
(RefSeq) reelin
  KO
K06249  reelin [EC:3.4.21.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    19699 (Reln)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    19699 (Reln)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    19699 (Reln)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    19699 (Reln)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     19699 (Reln)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR EGF_2 Reeler EGF_Tenascin hEGF
Motif
Other DBs
NCBI-GeneID: 19699
NCBI-ProteinID: NP_035391
MGI: 103022
Ensembl: ENSMUSG00000042453
Vega: OTTMUSG00000030584
UniProt: Q60841
LinkDB All DBs
Structure
PDB: 

Position
5 A3; 5 9.98 cM
AA seq 3461 aa AA seqDB search
MERGCWAPRALVLAVLLLLATLRARAATGYYPRFSPFFFLCTHHGELEGDGEQGEVLISL
HIAGNPTYYVPGQEYHVTISTSTFFDGLLVTGLYTSTSIQSSQSIGGSSAFGFGIMSDHQ
FGNQFMCSVVASHVSHLPTTNLSFVWIAPPAGTGCVNFMATATHRGQVIFKDALAQQLCE
QGAPTEATAYSHLAEIHSDSVILRDDFDSYQQLELNPNIWVECSNCEMGEQCGTIMHGNA
VTFCEPYGPRELTTTCLNTTTASVLQFSIGSGSCRFSYSDPSITVSYAKNNTADWIQLEK
IRAPSNVSTVIHILYLPEEAKGESVQFQWKQDSLRVGEVYEACWALDNILVINSAHREVV
LEDNLDPVDTGNWLFFPGATVKHSCQSDGNSIYFHGNEGSEFNFATTRDVDLSTEDIQEQ
WSEEFESQPTGWDILGAVVGADCGTVESGLSLVFLKDGERKLCTPYMDTTGYGNLRFYFV
MGGICDPGVSHENDIILYAKIEGRKEHIALDTLTYSSYKVPSLVSVVINPELQTPATKFC
LRQKSHQGYNRNVWAVDFFHVLPVLPSTMSHMIQFSINLGCGTHQPGNSVSLEFSTNHGR
SWSLLHTECLPEICAGPHLPHSTVYSSENYSGWNRITIPLPNAALTRDTRIRWRQTGPIL
GNMWAIDNVYIGPSCLKFCSGRGQCTRHGCKCDPGFSGPACEMASQTFPMFISESFGSAR
LSSYHNFYSIRGAEVSFGCGVLASGKALVFNKDGRRQLITSFLDSSQSRFLQFTLRLGSK
SVLSTCRAPDQPGEGVLLHYSYDNGITWKLLEHYSYVNYHEPRIISVELPDDARQFGIQF
RWWQPYHSSQGEDVWAIDEIVMTSVLFNSISLDFTNLVEVTQSLGFYLGNVQPYCGHDWT
LCFTGDSKLASSMRYVETQSMQIGASYMIQFSLVMGCGQKYTPHMDNQVKLEYSANHGLT
WHLVQEECLPSMPSCQEFTSASIYHASEFTQWRRVTVVLPQKTWSGATRFRWSQSYYTAQ
DEWALDNIYIGQQCPNMCSGHGSCDHGVCRCDQGYQGTECHPEAALPSTIMSDFENPSSW
ESDWQEVIGGEVVKPEQGCGVVSSGSSLYFSKAGKRQLVSWDLDTSWVDFVQFYIQIGGE
SAACNKPDSREEGILLQYSNNGGIQWHLLAEMYFSDFSKPRFVYLELPAAAKTPCTRFRW
WQPVFSGEDYDQWAVDDIIILSEKQKQVIPVVNPTLPQNFYEKPAFDYPMNQMSVWLMLA
NEGMAKNDSFCATTPSAMVFGKSDGDRFAVTRDLTLKPGYVLQFKLNIGCTSQFSSTAPV
LLQYSHDAGMSWFLVKEGCFPASAGKGCEGNSRELSEPTVYYTGDFEEWTRITIAIPRSL
ASSKTRFRWIQESSSQKNVPPFGLDGVYISEPCPSYCSGHGDCISGVCFCDLGYTAAQGT
CVSNTPNHSEMFDRFEGKLSPLWYKITGGQVGTGCGTLNDGRSLYFNGLGKREARTVPLD
TRNIRLVQFYIQIGSKTSGITCIKPRARNEGLVVQYSNDNGILWHLLRELDFMSFLEPQI
ISIDLPREAKTPATAFRWWQPQHGKHSAQWALDDVLIGVNDSSQTGFQDKFDGSIDLQAN
WYRIQGGQVDIDCLSMDTALIFTENIGKPRYAETWDFHVSASSFLQFEMNMGCSKPFSGA
HGIQLQYSLNNGKDWQLVTEECVPPTIGCVHYTESSTYTSERFQNWRRVTVYLPLATNSP
RTRFRWIQTNYTVGADSWAIDNVILASGCPWMCSGRGICDSGRCVCDRGFGGPFCVPVVP
LPSILKDDFNGNLHPDLWPEVYGAERGNLNGETIKSGTCLIFKGEGLRMLISRDLDCTNT
MYVQFSLRFIAKGTPERSHSILLQFSVSGGVTWHLMDEFYFPQTTSILFINVPLPYGAQT
NATRFRLWQPYNNGKKEEIWIIDDFIIDGNNLNNPVLLLDTFDFGPREDNWFFYPGGNIG
LYCPYSSKGAPEEDSAMVFVSNEVGEHSITTRDLSVNENTIIQFEINVGCSTDSSSADPV
RLEFSRDFGATWHLLLPLCYHSSSLVSSLCSTEHHPSSTYYAGTTQGWRREVVHFGKLHL
CGSVRFRWYQGFYPAGSQPVTWAIDNVYIGPQCEEMCYGHGSCINGTKCICDPGYSGPTC
KISTKNPDFLKDDFEGQLESDRFLLMSGGKPSRKCGILSSGNNLFFNEDGLRMLVTRDLD
LSHARFVQFFMRLGCGKGVPDPRSQPVLLQYSLNGGLSWSLLQEFLFSNSSNVGRYIALE
MPLKARSGSTRLRWWQPSENGHFYSPWVIDQILIGGNISGNTVLEDDFSTLDSRKWLLHP
GGTKMPVCGSTGDALVFIEKASTRYVVTTDIAVNEDSFLQIDFAASCSVTDSCYAIELEY
SVDLGLSWHPLVRDCLPTNVECSRYHLQRILVSDTFNKWTRITLPLPSYTRSQATRFRWH
QPAPFDKQQTWAIDNVYIGDGCLDMCSGHGRCVQGSCVCDEQWGGLYCDEPETSLPTQLK
DNFNRAPSNQNWLTVSGGKLSTVCGAVASGLALHFSGGCSRLLVTVDLNLTNAEFIQFYF
MYGCLITPSNRNQGVLLEYSVNGGITWNLLMEIFYDQYSKPGFVNILLPPDAKEIATRFR
WWQPRHDGLDQNDWAIDNVLISGSADQRTVMLDTFSSAPVPQHERSPADAGPVGRIAFEM
FLEDKTSVNENWLFHDDCTVERFCDSPDGVMLCGSHDGREVYAVTHDLTPTENWIMQFKI
SVGCKVPEKIAQNQIHVQFSTDFGVSWSYLVPQCLPADPKCSGSVSQPSVFFPTEGWKRI
TYPLPESLTGNPVRFRFYQKYSDVQWAIDNFYLGPGCLDNCGGHGDCLKEQCICDPGYSG
PNCYLTHSLKTFLKERFDSEEIKPDLWMSLEGGSTCTECGVLAENTALYFGGSTVRQAIT
QDLDLRGAKFLQYWGRIGSENNMTSCHRPVCRKEGVLLDFSTDGGITWTLLHEMDFQKYI
SVRHDYILLPEGALTNTTRLRWWQPFVISNGLVVSGVERAQWALDNILIGGAEINPSQLV
DTFDDEGSSHEENWSFYPNAVRTAGFCGNPSFHLYWPNKKKDKTHNALSSRELIIQPGYM
MQFKIVVGCEATSCGDLHSVMLEYTKDARSDSWQLVQTQCLPSSSNSIGCSPFQFHEATI
YNAVNSSSWKRITIQLPDHVSSSATQFRWIQKGEETEKQSWAIDHVYIGEACPKLCSGHG
YCTTGAVCICDESFQGDDCSVFSHELPSYIKDNFESARVTEANWETIQGGVIGSGCGQLA
PYAHGDSLYFNGCQIRQAATKPLDLTRASKIMFVLQIGSPAQTDSCNSDLSGPHTVDKAV
LLQYSVNNGITWHVIAQHQPKDFTQAQRVSYNVPLEARMKGVLLRWWQPRHNGTGHDQWA
LDHVEVVLVSTRKQNYMMNFSRQHGLRHFYNRRRRSLRRYP
NT seq 10386 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcggctgctgggcgccgcgggctctcgtcctggccgtgctgctgctgctggcg
acgctgagggcgcgcgcggccaccggctactacccgcgcttctcgcctttctttttcctg
tgcacccaccacggggagctggaaggggatggggagcagggcgaggtgctcatttccctg
cacattgcgggcaaccccacctactacgtaccgggacaggaataccatgttacaatttca
acaagcaccttctttgatggcttgctggtgacgggactctatacctcgacaagcatccag
tcttctcagagcattggaggctccagcgcctttggattcgggatcatgtccgaccaccag
tttggtaaccagtttatgtgcagtgtggtggcctctcatgtgagtcacctgcctacaacc
aacctcagctttgtctggattgccccaccagctggcacaggctgtgtgaatttcatggct
actgcaacacataggggccaggtgattttcaaagacgcactggcccagcagctgtgtgaa
caaggagctcccacagaggccactgcttactcgcaccttgctgaaatacacagtgacagt
gtgatcctacgagatgactttgactcctaccagcaactggaattgaaccccaacatatgg
gttgaatgcagcaactgtgagatgggagagcagtgtggcaccatcatgcatggcaatgct
gtcaccttctgtgagccgtacggccctcgagagctgaccaccacatgcctgaacacaaca
acagcatctgtcctccagttttccattgggtcaggatcatgtcgatttagttactctgac
cccagcatcactgtgtcatacgccaagaacaataccgctgattggattcagctggagaaa
attagagccccttccaatgtgagcacagtcatccacatcctgtacctccccgaggaagcc
aaaggggagagcgtgcagttccagtggaaacaggacagcctgcgagtgggtgaggtgtat
gaggcctgctgggccctggataacatcctggtcatcaattcagcccacagagaagtcgtt
ctggaggacaacctcgacccggtcgacacgggcaactggctcttcttccctggagcaacg
gtcaagcatagctgtcagtcagatgggaactccatttatttccatggaaatgaaggcagc
gagttcaattttgccaccacccgggatgtagatctttctacagaggatattcaagagcag
tggtcagaagaatttgagagccagcccacaggatgggatatcttgggagcagtagttggt
gcagactgtggaaccgtagaatcaggactatcactggtgttcctcaaagatggagagagg
aagctttgcaccccctacatggatacaactggttatggcaacctgaggttctacttcgtt
atgggaggaatctgtgaccctggagtctctcatgaaaacgatatcatcttatatgcaaag
attgaaggaagaaaagaacacattgcactggacactcttacctattcttcctataaggtt
ccgtctttggtttctgtggtcatcaaccctgaacttcagacacctgccaccaaattttgt
ctcaggcaaaagagccaccaagggtataatcggaatgtctgggctgtggacttcttccat
gtgctgcccgttctcccttcaacaatgtctcacatgatccagttttctattaatttggga
tgcggcacacaccagcctgggaacagcgtcagcttggagttttctactaaccatggacgg
tcctggtccctactccacactgagtgcttgccggagatctgtgcaggcccccacctcccc
cacagcactgtctactcctcagaaaactacagcgggtggaaccgaatcacgattcctctc
cctaatgcagcactcacccgagacaccaggattcgctggagacaaacaggcccaatcctg
ggaaatatgtgggcaattgataatgtttatataggtccttcgtgtctcaaattctgttct
ggcagaggacaatgcactcggcatggctgcaagtgtgacccaggattttctggcccagct
tgtgagatggcatctcagacattcccaatgtttatttcggaaagctttggcagtgccaga
ctttcctcttaccataacttttactctatccgtggtgctgaagtcagctttggttgtggt
gtcttagccagtggtaaggctctggttttcaacaaagatgggaggcggcagctaatcacg
tcctttctggacagctcgcagtccaggtttcttcagtttacactgaggctggggagcaag
tctgtgctgagcacgtgcagagcccctgaccagccgggggagggagtcctgctgcactat
tcatatgacaacgggataacatggaaactcctggagcactattcctacgtcaactaccac
gagcccagaataatctctgtagagctaccggatgatgcaagacagtttggaatccagttc
agatggtggcagccttaccattcttcccaaggagaagacgtgtgggccattgatgagatt
gtcatgacctcagtcctgttcaacagcatcagtctcgactttaccaatcttgtggaagtc
actcaatccctgggattctaccttggcaatgttcaaccatactgtggccatgactggacg
ctttgttttacgggagattctaaacttgcctcaagcatgcgctatgtggaaacacagtcc
atgcagatcggagcatcctatatgattcagttcagcctagtgatgggatgtggccagaaa
tacactcctcacatggacaaccaggtgaagctggagtactcagccaaccacggccttaca
tggcaccttgtacaagaagaatgccttcccagtatgccaagctgccaggaatttacatct
gccagcatttaccatgccagcgagttcacacagtggagaagagtcactgttgttcttccc
cagaaaacatggtccggtgccacccgcttccgttggagtcagagctattacacagcccag
gatgagtgggctttagacaacatttacattgggcagcagtgccccaacatgtgcagtggg
catggctcatgtgaccatggcgtgtgcaggtgtgaccagggataccagggcactgaatgc
cacccagaagctgcacttccttccacgattatgtcagattttgagaacccgagcagttgg
gaatcagactggcaggaagttattgggggagaagttgtaaagcctgagcaaggctgtgga
gtcgtgtcttctggatcttctctgtacttcagcaaggctgggaagaggcagctggtgagc
tgggacctggacacatcctgggtggactttgtccagttctacatccagataggaggagag
agtgctgcatgcaacaagcctgacagcagagaggagggcattctgctccagtatagcaac
aacgggggcatccagtggcacctgctggcagagatgtacttctcagacttcagcaaaccc
agatttgtctacctggagctcccagctgctgcgaagaccccttgtaccaggttccgctgg
tggcagcctgtgttctcgggggaggactatgaccagtgggccgttgatgatatcatcatt
ctgtcagagaagcagaagcaggttattccagttgtcaacccaactttgccccagaacttc
tatgagaagccagctttcgattaccctatgaaccaaatgagtgtgtggctaatgttggcc
aatgaaggcatggctaaaaacgacagcttctgtgcgaccacgccgtcagccatggtgttt
ggaaagtcagatggagaccggtttgcagtaactcgagatctgaccctgaaacctggatat
gtgctgcagttcaagctaaacataggctgcaccagccagttcagcagcactgccccggtt
ctcctgcagtattcacatgatgccggcatgtcgtggtttctggtgaaggaaggatgcttc
ccagcgtcagcaggcaaaggatgtgaagggaactccagggaattgagtgagcctactgtc
tattatactggggacttcgaagaatggactagaatcaccattgccattccaaggtccctt
gcatccagcaagaccagattccgatggatccaagagagcagctctcagaagaatgtgccc
ccgtttggcttagatggggtgtacatatctgagccttgtcccagttactgcagtggccat
ggagactgcatctcgggggtgtgtttttgtgacctggggtacacagctgcacaaggaacc
tgtgtgtcaaacacccctaaccacagtgagatgttcgacaggtttgaggggaagctaagc
ccactgtggtacaaaatcaccgggggtcaggttggcacgggctgtggcaccctcaatgac
ggcaggtccctctactttaatggccttgggaaaagggaagccaggacagtcccactggac
accaggaatatcagacttgttcagttttatatacaaattggaagtaaaacatcagggatt
acgtgcatcaaaccacgggctagaaatgaggggcttgttgttcagtattccaatgataat
gggatactttggcatttgctgagagagttggatttcatgtcattcctggagccacagatc
atttccattgacctgccccgggaagcaaagacacctgccacagctttccggtggtggcag
ccgcagcatgggaagcattcggcccagtgggctttggatgatgtccttataggagtgaat
gacagctctcaaactggatttcaagataaatttgatggctccatagacttgcaagccaac
tggtatcgaatccagggaggccaagttgatatcgactgcctctctatggacactgccctt
atattcactgaaaacataggaaaacctcgctatgctgagacctgggacttccatgtgtca
gcgtcaagcttcttacagtttgaaatgaacatgggctgcagcaagcctttcagtggtgcc
cacggcatacagctccagtactctctgaacaacggcaaggactggcagcttgtcaccgaa
gagtgtgtccctccaaccattggctgcgtgcactacacagagagttcaacttacacatca
gaaagattccagaactggaggcgggtcacggtctacctgccactcgccaccaattctccc
aggactcggttcagatggattcagaccaactatactgttggagcagattcctgggctatt
gataatgtcatcctggcctcgggctgtccttggatgtgctcaggacgagggatctgtgat
tcggggcgctgtgtgtgtgaccggggcttcggtggacccttctgtgttcctgttgttcct
cttccctccattctaaaagatgatttcaatgggaacttacatcctgacctttggcctgaa
gtgtacggggcagagaggggcaatctgaatggcgaaaccatcaaatccggaacatgtctg
atctttaaaggggagggactaagaatgcttatttccagagatctagattgcaccaatact
atgtatgtccagttctctctccgatttatagcgaaaggtaccccagagaggtctcactcc
atccttctacagttctctgtcagtggaggagtcacctggcacctgatggatgaattctac
ttccctcaaacgaccagcatacttttcatcaatgttcccttaccatacggtgcccaaacc
aacgctacaagattcagactctggcaaccgtacaataatggtaagaaagaagaaatctgg
atcattgatgactttattattgatggaaacaatttgaacaaccccgtgctgctgctggac
acgttcgactttgggcccagggaagacaattggtttttctatccgggtggtaatatcgga
ctttactgcccgtattcttcaaagggagctcctgaggaggattcggccatggtgtttgtt
tcaaacgaagttggagaacactccattaccacacgagacctaagtgtgaacgagaacacc
atcattcaatttgagatcaatgttggctgctccactgatagttcttctgctgatccggtc
agactggaattctcaagggactttggagccacctggcacctgctgctgcctctctgctac
cacagcagcagcctcgtcagctccttatgctccactgagcatcacccgagcagcacctac
tacgcggggaccacccagggctggcggcgggaggtcgtgcacttcggaaagctgcacctt
tgtggatctgtgcgtttccgttggtaccagggattttatcctgctggctctcagccggtc
acatgggccattgacaatgtctacattggtccccagtgtgaagagatgtgctatgggcac
gggagctgcatcaatggaaccaagtgtatatgtgacccgggctactctgggccaacctgt
aaaataagcaccaaaaatcctgattttctcaaagacgactttgaaggtcaactggaatcc
gatcgattcttactgatgagcggtgggaagccgtctcgtaagtgtggcatcctttccagt
gggaacaacctcttcttcaatgaggacggcttgcgcatgctagtaacacgggacctggat
ttatcacatgcaaggtttgtgcagttcttcatgagactgggatgtggtaaaggtgttcca
gaccccaggagccagcccgtgcttctgcagtactccctcaatggcggcctctcctggagt
cttcttcaagagttcctcttcagcaactccagcaatgtgggcaggtacattgccctggaa
atgcccctgaaagcccgttctggttcgacacgcctccgctggtggcagccatctgaaaat
gggcacttctatagcccctgggtgatcgaccagattcttattggaggaaatatctctggt
aatacagtcttagaagatgatttctcaactctggacagcagaaagtggctgcttcaccca
ggaggcaccaagatgcctgtgtgtggctccacaggcgatgccctggtctttattgaaaag
gccagcacccgttacgtggtcacgacagacatcgctgtgaatgaggactcattcctacag
atagactttgctgcctcctgctcagtcacagactcctgctatgctattgaactggagtac
tcggtggatctcggtctgtcgtggcacccgctggtgagggactgcctgcctaccaatgtt
gagtgtagtcgttaccacctgcagcggatcctggtgtcagatactttcaacaagtggacc
agaatcactctgcccctgccttcctacaccaggtctcaagccactcgtttccgctggcat
cagccagcgccttttgacaagcagcagacctgggcaatagataatgtctatattggggat
ggttgcctagacatgtgcagtggccacgggagatgcgtccagggaagctgtgtctgtgat
gaacagtggggaggcctgtactgtgatgagcctgagacctcccttcccacccagctcaaa
gacaacttcaaccgagccccctccaaccagaactggctgactgtgagcggtgggaagctg
agtacagtgtgtggggctgtggcttccggcctggctctccatttcagtgggggctgcagc
cgattgttagtcactgtggatctgaacctcaccaatgctgagtttatccagttttacttt
atgtatggatgcctcattacgccgagcaaccgtaaccagggagtcctgctggagtactct
gtcaatggaggcatcacctggaacttgctgatggagattttctatgaccagtacagcaaa
cctggatttgtgaatatccttctccctcctgatgctaaagagattgccactcgcttccga
tggtggcagccacgacatgatggccttgaccagaatgactgggccattgacaatgtcctc
atctcgggctctgcggaccagaggacagtcatgctggacacctttagcagcgccccagta
ccacagcatgagcgctcccccgcagacgctggccctgttggaagaattgcttttgaaatg
ttcttagaagacaaaacttcagtgaatgagaattggctcttccatgatgactgtacagtg
gaaagattctgtgactcgccagatggtgtcatgctctgtggcagccatgatggacgagag
gtgtatgcagtgactcatgacctgacgcccactgagaactggatcatgcagttcaagatc
tctgttggatgcaaagtgcctgaaaaaattgcccagaatcaaattcacgtgcagttttct
actgactttggcgtgagctggagttatttagtccctcagtgcttacccgccgacccaaag
tgttctggaagcgtttctcaaccgtctgtgttcttcccaactgaagggtggaaaaggatc
acctacccgcttcctgaaagcttaacggggaatcctgtaagatttaggttctaccaaaag
tactcagatgtgcagtgggcaattgacaatttctaccttggccctggatgtttggacaac
tgtggaggccacggagactgcctaaaggaacagtgtatctgtgacccaggctactcaggg
ccaaactgctacttaactcacagcctgaagactttcctgaaggagcgctttgacagtgag
gagatcaagcctgacttatggatgtccttggaaggcggaagcacttgtacagagtgcggg
gtcctcgccgagaacactgcactctattttgggggatccactgtgagacaagctattact
caagacttagatctcagaggtgcaaaattcctgcagtactggggacgtatcggcagtgag
aacaacatgacatcttgccatcggcctgtctgccggaaggaaggcgtgctgctggacttc
tctacggatggaggaatcacttggaccttgcttcacgagatggatttccagaaatacatt
tctgtgaggcacgactacatcctcctgcctgagggggccctcaccaacacaactcgactt
cgctggtggcagccttttgtcatcagcaatgggctcgtggtttccggggtggagcgtgcg
cagtgggcactggacaacattctgattggtggagcagaaatcaatccaagccaactggtg
gacactttcgatgacgaaggctcctcccatgaagaaaactggagtttttaccctaatgca
gtaaggacagcaggattctgtggcaacccatccttccacctctactggccaaataaaaag
aaggacaagacccacaatgcactctcctcccgagagctcattatacagccaggatacatg
atgcaatttaaaattgtggtgggttgtgaagccacttcatgtggtgaccttcattccgtg
atgctggagtacaccaaggatgcaaggtccgattcctggcagctcgtgcagacccagtgc
ctaccttcctcttccaatagcattggctgctccccgttccagttccatgaagccaccatt
tataatgctgtcaacagctcaagctggaagaggatcaccatccagctcccagaccacgtc
tcgtcaagtgccacacagttccgctggatccagaagggagaagaaaccgagaagcaaagc
tgggccatcgaccacgtgtacatcggagaggcttgtcccaagctctgcagcgggcatggc
tactgcaccacaggggccgtctgcatctgcgatgaaagcttccaaggtgacgactgctct
gtcttcagtcacgagcttcctagttacattaaagataattttgaatcagcaagagtcact
gaagccaactgggaaaccatccagggtggagtgatcggaagtggctgtgggcagctggcg
ccctatgcccatggagattcgctctactttaatggttgtcagataaggcaagctgccacc
aagccactggacctcactcgagcaagcaaaattatgtttgtcttgcaaattgggagccca
gcccagacagacagttgcaacagcgacctcagcggcccccacaccgtggacaaagcagta
ctgctgcagtacagtgtcaacaatggcatcacctggcacgtcatcgctcagcaccagccg
aaggacttcacacaagctcagcgggtgtcttacaacgtccccctggaagctcggatgaaa
ggagttctactgcgctggtggcagccacgccacaatggaacaggtcatgatcaatgggct
ttggaccatgtggaggtcgtcctagtaagcactcgcaaacaaaattacatgatgaatttt
tcacggcaacatgggctcaggcacttctacaacagaagacgaaggtcgcttaggcgatac
ccatga

DBGET integrated database retrieval system