Mus musculus (house mouse): 20210 Help Entry 20210             CDS       T01002                                  Symbol Saa3, Saa-3, l7R3 Name (RefSeq) serum amyloid A 3   KO K17310   serum amyloid A protein Organism mmu  Mus musculus (house mouse) Brite KEGG Orthology (KO) [BR:mmu00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     20210 (Saa3) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of other cancer cells    20210 (Saa3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SAA Motif Other DBs NCBI-GeneID:  20210 NCBI-ProteinID:  NP_035445 MGI:  98223 Ensembl:  ENSMUSG00000040026 UniProt:  P04918 Structure PDBPDBj LinkDB All DBs Position 7:complement(46361422..46365100) Genome browser AA seq 122 aa AA seqDB search MKPSIAIILCILILGVDSQRWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNY DAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPK RY NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgaagccttccattgccatcattctttgcatcttgatcctgggagttgacagccaaaga tgggtccagttcatgaaagaagctggtcaagggtctagagacatgtggcgagcctactct gacatgaagaaagctaactggaaaaactcagacaaatacttccatgctcgggggaactat gatgctgcccggaggggtcccgggggagcctgggctgctaaagtcatcagcgatgccaga gaggctgttcagaagttcacgggacatggagcagaggactcaagagctgaccagtttgcc aatgagtggggccggagtggcaaagaccccaaccacttccgacctgctggcctgcctaaa agatactga

DBGET integrated database retrieval system