Mus musculus (house mouse): 20293 Help Entry 20293             CDS       T01002                                  Symbol Ccl12, MCP-5, Scya12 Name (RefSeq) C-C motif chemokine ligand 12   KO K14624   C-C motif chemokine 2 Organism mmu  Mus musculus (house mouse) Pathway mmu04060   Cytokine-cytokine receptor interaction mmu04061   Viral protein interaction with cytokine and cytokine receptor mmu04062   Chemokine signaling pathway mmu04621   NOD-like receptor signaling pathway mmu04657   IL-17 signaling pathway mmu04668   TNF signaling pathway mmu04933   AGE-RAGE signaling pathway in diabetic complications mmu05135   Yersinia infection mmu05142   Chagas disease mmu05144   Malaria mmu05163   Human cytomegalovirus infection mmu05164   Influenza A mmu05168   Herpes simplex virus 1 infection mmu05171   Coronavirus disease - COVID-19 mmu05323   Rheumatoid arthritis mmu05417   Lipid and atherosclerosis mmu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     20293 (Ccl12)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     20293 (Ccl12)    04061 Viral protein interaction with cytokine and cytokine receptor     20293 (Ccl12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     20293 (Ccl12)    04657 IL-17 signaling pathway     20293 (Ccl12)    04062 Chemokine signaling pathway     20293 (Ccl12)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     20293 (Ccl12)    05164 Influenza A     20293 (Ccl12)    05168 Herpes simplex virus 1 infection     20293 (Ccl12)    05163 Human cytomegalovirus infection     20293 (Ccl12)   09171 Infectious disease: bacterial    05135 Yersinia infection     20293 (Ccl12)   09174 Infectious disease: parasitic    05144 Malaria     20293 (Ccl12)    05142 Chagas disease     20293 (Ccl12)   09163 Immune disease    05323 Rheumatoid arthritis     20293 (Ccl12)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     20293 (Ccl12)    05418 Fluid shear stress and atherosclerosis     20293 (Ccl12)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     20293 (Ccl12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmu04052]     20293 (Ccl12)    00536 Glycosaminoglycan binding proteins [BR:mmu00536]     20293 (Ccl12) Cytokines and neuropeptides [BR:mmu04052]  Cytokines   Chemokines    20293 (Ccl12) Glycosaminoglycan binding proteins [BR:mmu00536]  Heparan sulfate / Heparin   Chemokines    20293 (Ccl12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  20293 NCBI-ProteinID:  NP_035461 MGI:  108224 Ensembl:  ENSMUSG00000035352 UniProt:  Q62401 Q545B5 LinkDB All DBs Position 11:81992671..81994225 Genome browser AA seq 104 aa AA seqDB search MKISTLLCLLLIATTISPQVLAGPDAVSTPVTCCYNVVKQKIHVRKLKSYRRITSSQCPR EAVIFRTILDKEICADPKEKWVKNSINHLDKTSQTFILEPSCLG NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgaagatttccacacttctatgcctcctgctcatagctaccaccatcagtcctcaggta ttggctggaccagatgcggtgagcaccccagtcacgtgctgttataatgttgttaagcag aagattcacgtccggaagctgaagagctacaggagaatcacaagcagccagtgtccccgg gaagctgtgatcttcaggaccatactggataaggagatctgtgctgaccccaaggagaag tgggttaagaattccataaaccacttggataagacgtctcaaaccttcatccttgaacct tcatgtctaggctga

DBGET integrated database retrieval system