KEGG   Mus musculus (house mouse): 207683
Entry
207683            CDS       T01002                                 
Symbol
Igsf11, 1700025L02Rik, BT-IgSF, Igsf13
Name
(RefSeq) immunoglobulin superfamily, member 11
  KO
K06791  immunoglobulin superfamily, member 11
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    207683 (Igsf11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    207683 (Igsf11)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  CTX family
   207683 (Igsf11)
SSDB
Motif
Pfam: V-set Ig_3 ig Ig_2 I-set stn_TNFRSF12A
Other DBs
NCBI-GeneID: 207683
NCBI-ProteinID: NP_733548
MGI: 2388477
Ensembl: ENSMUSG00000022790
UniProt: P0C673
LinkDB
Position
16:38712840..38847521
AA seq 428 aa
MTRRRSAPASWLLVSLLGVATSLEVSESPGSVQVARGQTAVLPCAFSTSAALLNLNVIWM
VIPLSNANQPEQVILYQGGQMFDGALRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQC
LVNNLPDRGGRNIGVTGLTVLVPPSAPQCQIQGSQDLGSDVILLCSSEEGIPRPTYLWEK
LDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRSV
GVIAGAVGTGAVLIVICLALISGAFFYWRSKNKEEEEEEIPNEIREDDLPPKCSSAKAFH
TEISSSENNTLTSSNTYNSRYWNNNPKPHRNTESFNHFSDLRQSFSGNAVIPSIYANGNH
LVLGPHKTLVVTANRGSSPQVLPRNNGSVSRKPWPQHTHSYTVSQMTLERIGAVPVMVPA
QSRAGSLV
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgactcggcggcgctccgctccggcgtcctggctgctcgtgtcgctgctcggtgtcgca
acatccctggaagtgtccgagagcccaggcagtgtccaggtggcccggggccagacagca
gtcctgccctgcgccttctccaccagtgctgccctcctgaacctcaatgtcatttggatg
gtcattcccctctccaatgcaaaccagcccgaacaggtcattctttatcagggtggacaa
atgtttgacggcgccctccggttccacgggagggtaggatttaccggcaccatgcctgct
accaatgtctcgatcttcatcaataacacacagctgtcagatacgggcacgtaccagtgc
ttggtgaataaccttccagacagagggggcagaaacatcggggtcactggcctcacagtg
ttagtccccccttctgctccacaatgccaaatccaaggatcccaggacctcggcagtgac
gtcatccttctgtgtagttcagaggaaggcatccctcggcccacgtacctttgggagaag
ttagataatacgctcaagctacctccaacagccactcaggaccaggtccagggaacagtc
accatccggaatatcagtgccctctcttccggtctgtaccagtgtgtggcttctaatgcc
atcgggaccagcacctgtctgctggacctccaggttatctcaccccagccccggagcgtt
ggagtaatagccggagcggttggcaccggtgctgttcttatcgtcatctgccttgcacta
atttcaggggcgttcttttactggagaagcaaaaacaaagaggaggaggaggaagaaatt
cctaatgaaatcagagaggatgatcttccccctaaatgctcttctgccaaagccttccac
acggagatatcctcctcagaaaataacacgctgacctcttccaatacctacaacagtcga
tactggaacaacaatccaaaaccccatagaaacacagagtctttcaaccacttcagtgac
ttacgccagtctttctctggcaatgcagttatcccatcaatctatgcaaatgggaaccat
ctggttttgggtccacataagactctggtagttacagccaacagagggtcatcacctcag
gtcttgcccaggaacaatggttcagtcagcaggaagccttggcctcaacacactcattcc
tacacagtaagccaaatgaccctggagcgcatcggtgcagtgcctgtcatggtgcctgcc
cagagtcgagcagggtccctggtatag

DBGET integrated database retrieval system