KEGG   Mus musculus (mouse): 20779Help
Entry
20779             CDS       T01002                                 

Gene name
Src, AW259666, pp60c-src
Definition
(RefSeq) Rous sarcoma oncogene
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04012  ErbB signaling pathway
mmu04015  Rap1 signaling pathway
mmu04062  Chemokine signaling pathway
mmu04137  Mitophagy - animal
mmu04144  Endocytosis
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04530  Tight junction
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04625  C-type lectin receptor signaling pathway
mmu04727  GABAergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04810  Regulation of actin cytoskeleton
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04926  Relaxin signaling pathway
mmu05100  Bacterial invasion of epithelial cells
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05219  Bladder cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    20779 (Src)
   04012 ErbB signaling pathway
    20779 (Src)
   04370 VEGF signaling pathway
    20779 (Src)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    20779 (Src)
   04137 Mitophagy - animal
    20779 (Src)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    20779 (Src)
   04520 Adherens junction
    20779 (Src)
   04530 Tight junction
    20779 (Src)
   04540 Gap junction
    20779 (Src)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    20779 (Src)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    20779 (Src)
   04625 C-type lectin receptor signaling pathway
    20779 (Src)
   04062 Chemokine signaling pathway
    20779 (Src)
  09152 Endocrine system
   04912 GnRH signaling pathway
    20779 (Src)
   04915 Estrogen signaling pathway
    20779 (Src)
   04917 Prolactin signaling pathway
    20779 (Src)
   04921 Oxytocin signaling pathway
    20779 (Src)
   04926 Relaxin signaling pathway
    20779 (Src)
   04919 Thyroid hormone signaling pathway
    20779 (Src)
  09156 Nervous system
   04727 GABAergic synapse
    20779 (Src)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    20779 (Src)
  09158 Development
   04360 Axon guidance
    20779 (Src)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    20779 (Src)
   05203 Viral carcinogenesis
    20779 (Src)
  09162 Cancers: Specific types
   05219 Bladder cancer
    20779 (Src)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    20779 (Src)
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    20779 (Src)
   05100 Bacterial invasion of epithelial cells
    20779 (Src)
  09172 Infectious diseases: Viral
   05161 Hepatitis B
    20779 (Src)
   05163 Human cytomegalovirus infection
    20779 (Src)
   05167 Kaposi sarcoma-associated herpesvirus infection
    20779 (Src)
  09176 Drug resistance: Antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    20779 (Src)
   01522 Endocrine resistance
    20779 (Src)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    20779 (Src)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20779 (Src)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     20779 (Src)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  SRC family
   20779 (Src)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    20779 (Src)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    20779 (Src)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    20779 (Src)
  Macropinocytosis
   Kinases
    20779 (Src)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 20779
NCBI-ProteinID: NP_033297
MGI: 98397
Ensembl: ENSMUSG00000027646
Vega: OTTMUSG00000016179
UniProt: P05480
LinkDB All DBs
Structure
PDB: 

Position
2 H1; 2 78.35 cM
AA seq 541 aa AA seqDB search
MGSNKSKPKDASQRRRSLEPSENVHGAGGAFPASQTPSKPASADGHRGPSAAFVPPAAEP
KLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRKVD
VREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTF
LVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSK
HADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRV
AIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKG
ETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIE
DNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVL
DQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGEN
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggacgccagccagcggcgccgcagcctggagccc
tcggaaaacgtgcacggggcagggggcgccttcccggcctcacagacaccgagcaagccc
gcctccgccgacggccaccgcgggcccagcgccgccttcgtgccgcccgcggccgagccc
aagctcttcggaggcttcaactcctcggacaccgtcacctccccgcagagggcggggcct
ctggcaggtggggtgaccacctttgtggccctctatgactatgagtcacggacagagact
gacctgtccttcaagaaaggggagcggctgcagattgtcaataacacgaggaaggtggat
gtcagagagggagactggtggctggcacactcgctgagcacgggacagaccggttacatc
cccagcaactatgtggcgccctccgactccatccaggctgaggagtggtactttggcaag
atcactagacgggaatcagagcggctgctgctcaacgccgagaacccgagagggaccttc
ctcgtgagggagagtgagaccacaaaaggtgcctactgcctctctgtatccgacttcgac
aatgccaagggcctaaatgtgaaacactacaagatccgcaagctggacagcggcggtttc
tacatcacctcccgcacccagttcaacagcctgcagcagctcgtggcttactactccaaa
catgctgatggcctgtgtcaccgcctcactaccgtatgtcccacatccaagcctcagacc
cagggattggccaaggatgcgtgggagatcccccgggagtccctgcggctggaggtcaag
ctgggccagggttgcttcggagaggtgtggatggggacctggaacggcaccacgagggtt
gccatcaaaactctgaagccaggcaccatgtccccagaggccttcctgcaggaggcccaa
gtcatgaagaaactgaggcacgagaaactggtgcagctgtatgctgtggtgtcggaagaa
cccatttacattgtgacagagtacatgaacaaggggagtctgctggactttctcaagggg
gaaacgggcaaatatttgcggctaccccagctggtggacatgtctgctcagatcgcttca
ggcatggcctatgtggagcggatgaactatgtgcaccgggaccttcgagccgccaatatc
ctagtaggggagaacctggtgtgcaaagtggccgactttgggttggcccggctcatagaa
gacaacgaatacacagcccggcaaggtgccaaattccccatcaagtggaccgcccctgaa
gctgctctgtacggcaggttcaccatcaagtcggatgtgtggtcctttgggattctgctg
accgagctcaccactaagggaagagtgccctatcctgggatggtgaaccgtgaggttctg
gaccaggtggagcggggctaccggatgccttgtccccccgagtgccccgagtccctgcat
gaccttatgtgccagtgctggcggaaggagcccgaggagcggcccaccttcgagtacctg
caggccttcctggaagactactttacgtccactgagccacagtaccagcccggggagaac
ctatag

DBGET integrated database retrieval system