KEGG   Mus musculus (house mouse): 21872
Entry
21872             CDS       T01002                                 
Symbol
Tjp1, ZO1
Name
(RefSeq) tight junction protein 1
  KO
K05701  tight junction protein 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04520  Adherens junction
mmu04530  Tight junction
mmu04540  Gap junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    21872 (Tjp1)
   04530 Tight junction
    21872 (Tjp1)
   04540 Gap junction
    21872 (Tjp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    21872 (Tjp1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     21872 (Tjp1)
SSDB
Motif
Pfam: PDZ ZU5 PDZ_6 PDZ_2 Peptidase_M50 Guanylate_kin SH3_2 DUF6288 SH3_1 RPOL_N
Other DBs
NCBI-GeneID: 21872
NCBI-ProteinID: NP_033412
MGI: 98759
Ensembl: ENSMUSG00000030516
UniProt: P39447
Structure
LinkDB
Position
7:complement(64945913..65177629)
AA seq 1745 aa
MSARAAAAKSTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVL
KGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSHPD
PEPVSDNEDDSYDEEVHDPRAGRGALANRRSEKSWARDRSASRERSLSPRSDRRSVASSQ
PAKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENM
SLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHS
GRSHDRPPRRSQSRSPDQRSEPSDHSTQSPQQPSNGSLRSREEERMSKPGAISTPVKHVD
DHPPKAVEEVTVEKNEKQTPTLPEPKPVYAQVGQPDVDLPVSPSDGALPNSAHEDGILRP
SMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIR
EEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKG
EVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRAD
FWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREK
LAREEPDIYQIAKSEPRDAGTDHRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQ
WYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMND
GWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHT
SDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSP
QAQPQAIHRIDSPGLKPASQQKAEASSPVPYLSPETTPASSASAVNHNVSVTNVSLEEPA
PAPPTSHASQPGCLGAPSAEAAHVVLRGEGPPLPPHADPAKVYRKEPYSEEMMRQNHILK
QPALGHPGQRPDKEPNLAYEPQLPYIEKQASRDLEQPSYRYEVSSYTDQFSRNYDHRLRF
EDRIPTYEDQWSYYDDKQPYQPRPFENQHPRDLDSRQHPEEASERGYFQRFEEPAPLSYD
SRTRYEQLPRTSTLRHEEQPAPAYEVHNRYRPEAQPYSSTGPKSSEPKQYFDQYPRSYEQ
VPPPGFTSKTGHYEPLHGAAVVPPLIPSSQQKPEVLPSATKPQPPPPTLTEEEEDPAMKP
QSVLTRVKMFENKRSASLENKKDVNDTASFKPPEVASKPPGASLAGPKPVPQSQFSEHDK
TLYRLPEPQKPQVKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFESKPSAHLPAGHHS
EPAKPVHSQSQPNFSSYSSKGKPETDAVDRSFSEKRYDPAQATPPPPPLPSQYSQPAPPL
SSSSLHIHSKGAQGEGNSVSLDFQNSYMSKPDPPPSQSKPATFRPPTREDPPQTFYPQKS
FPDKAPVNGAEQTQKTITPVYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETVHKPEL
SSKTPTSPKTLMKAHSSTQPPEFDSGVETFSVHTDKPKYQMNNISTMPKAVPVSPSAVEE
DEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGIEQEIYFKVCRDNSILP
PLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSV
LIDHF
NT seq 5238 nt   +upstreamnt  +downstreamnt
atgtccgccagggccgcggccgctaagagcacagcaatggaggaaacagctatatgggaa
cagcacacagtgacgcttcacagggctcctgggtttggatttggaattgcaatctctggt
ggaagagataatcctcattttcagagtggggaaacctccatagtgatttctgatgtgtta
aaaggagggccagctgaaggacagctacaggaaaatgaccgagttgcaatggttaacgga
gtttcaatggataacgttgaacatgcttttgctgttcagcagctaaggaagagtgggaaa
aacgcaaaaattactatccgaaggaagaagaaagttcagatccctgtaagtcacccagat
cctgagccggtgtctgataatgaagacgatagttatgacgaagaagtgcatgacccaaga
gctggccgcggtgctttagcgaacagaaggagcgagaagagctgggcaagggataggagt
gcaagcagggagaggagcctgtcccctcgctcggacaggcggtccgtggcctccagtcag
cccgcaaagcccaccaaggtcacactggtgaagtctcggaaaaatgaagaatatggtctt
cgattggccagccatatatttgtaaaggaaatttcacaagatagtttggcagcaagagat
ggtaacattcaagaaggggatgttgtcttgaagataaatggtactgtgacagaaaatatg
tcattgacagatgcaaaaacactgatagaaaggtctaaaggcaagttaaaaatggtagtg
caaagagatgagcgggctaccttactgaacgtccctgacctttcggatagtatccattct
gctaatgcctcggaaagagatgacatttcagaaattcagtcactagcatcagaccattca
ggtcgctcgcatgacaggccaccccgccgcagccagtcacgatctcctgaccaacgttca
gagccctccgatcattccacgcagtctccacagcagcccagcaatggcagtctccggagc
agagaggaagagcgaatgtctaaacctggggccatctcaactcctgtaaaacatgtagac
gatcatccacccaaagcagtggaagaagttacagttgagaaaaatgagaagcagacgccc
actcttccagaaccgaaacctgtgtatgctcaagttggacaaccagatgtggatttaccc
gtcagcccttctgatggtgctctgcctaattcagctcatgaagacgggatacttaggccc
agcatgaaactggtaaaattcagaaaaggagatagtgtgggtttgcgactagctggtgga
aatgatgtcggaatatttgtagctggcgttctagaagatagccctgcagccaaagaaggc
ttagaggaaggtgatcaaattctcagggtgaacaatgtagatttcacaaatatcataagg
gaagaggccgtccttttcctccttgacctccctaaaggtgaagaagtgaccatactggct
cagaagaagaaggacgtttatcgccgcattgtagaatcagatgtaggagattcattctat
attagaacgcattttgaatatgaaaaagaatctccttacggacttagttttaacaaagga
gaggtgttccgggtcgtggatactttatacaatggaaagctgggctcttggcttgccatt
cgaattggcaaaaatcataaggaggtagaacgaggcatcatccctaataagaacagagct
gaacagttagccagtgtacagtacacacttccaaagacagcgggtggtgatcgggcagac
ttctggaggtttcgaggtcttcgcagctccaagagaaatcttcgaaaaagcagagaggac
ttgtcagctcagccagttcaaactaagttcccagcttatgaaagggttgttcttcgagaa
gctggattcctaagacctgtaaccatctttggaccaatagctgatgttgccagagaaaag
ttggcaagagaggagccagatatctatcagattgcaaaaagtgaaccacgagatgctggg
actgaccatcgtagctctggcatcattcgccttcatacaataaagcaaatcatagatcag
gataaacatgctttattagatgtaacgccaaatgcggttgatcgtcttaattatgcgcag
tggtatccaattgttgtgttccttaaccctgactctaagcaaggtgtaaaaacaatgagg
atgaggttgtgtccggagtctcggaaaagcgccaggaagctatatgaacgctctcataag
cttcgtaagaacaatcaccatctcttcacaactacaattaacttaaactcaatgaatgat
ggttggtacggtgccctgaaagaagcgattcagcagcaacagaaccagctggtgtgggtc
tctgaggggaaggcggatggtgctacaagtgatgaccttgatttgcatgacgatcgtctg
tcctacctgtcagccccaggtagtgagtactcaatgtatagcacggacagtagacacact
tctgactatgaagacacagatacagaaggcggggcctacactgatcaagaactagatgaa
actcttaatgatgaggtggggactcccccggagtctgccattacacggtcctctgagcct
gtaagagaggattcctctggaatgcatcatgaaaaccagacataccctccttactcacca
caagcgcagccacaagctattcatagaatagactcccctggacttaagccagcctctcaa
cagaaagcagaagcctcatctccagtcccttacctttcgcctgaaacaaccccagcatca
tcagcctctgcagttaatcataatgtcagtgtaactaatgtcagcctggaggagcctgcc
ccagcccctcccacctcgcacgcatcacagcctggttgtttaggagcaccaagtgctgag
gcagctcacgtagtgctcagaggtgaaggaccaccattgccgccgcatgcagacccagca
aaggtgtacaggaaggagccgtattctgaagaaatgatgagacaaaaccatattttaaaa
caaccagctcttggtcacccagggcagaggccagataaagagccaaatctagcctatgaa
ccccaacttccatatatagaaaaacaagccagcagagaccttgagcagccgtcatacagg
tatgaggtctcaagctacacagaccagttttctcggaactatgaccatcgcctacggttt
gaagatcgaatccctacctatgaagaccagtggtcatattatgatgacaaacagccctac
caacctcggccttttgagaatcagcatccccgagacctggactccagacaacatcccgaa
gaggcttcagaacgaggttatttccagcgttttgaagagccagcccctctgtcgtacgac
agtagaacacgctatgagcagctgcctcgaacctctactctacgacatgaagagcagcca
gcccctgcatatgaggtgcacaacaggtacaggccagaggcacagccctattcttcaaca
ggccctaagtcatctgagcccaagcagtactttgaccagtacccgcgaagttatgagcaa
gttccaccaccaggctttacctccaaaacaggccattacgagcctctccatggtgctgca
gttgtccctcctctgataccttcctctcaacaaaagccagaagtcctgccctcggctacc
aaaccacagcctccacccccaaccctaactgaggaggaggaggatccagcaatgaaacca
cagtctgtgctcaccagagtcaaaatgtttgaaaacaaaagatctgcgtctttggagaac
aagaaagatgtgaatgacactgccagctttaagcctccggaagtagcatctaaacctcca
ggtgcttctcttgctggccctaaacctgtccctcagagtcagtttagtgagcacgacaaa
acgctctacaggctcccagagcctcagaaacctcaagtgaagccacccgaagatattgtt
cgatcaaatcattacgaccctgaagaggatgaagaatattaccggaaacagctctcctac
tttgaccgaagaagttttgagagcaagccttctgcacatcttcctgctggccatcactca
gagcctgctaagccagtccattctcagagccagcccaacttctctagttactcttcaaag
ggaaaacccgaaactgatgctgtggatagatcattcagtgagaaacgttatgatccagcc
caggccacgcctcctcctcctccgttgccctcacagtacagccagccagctccacctctg
tccagctcttctctccacatacattccaagggcgcccagggtgaaggcaactcagtatca
ttggattttcagaactcatatatgtccaaaccagacccacccccatctcagagtaaacca
gcaactttcagaccaccaactcgagaagacccccctcagactttctatccgcagaaaagt
ttcccagacaaagctccagttaacggagctgagcagactcagaaaaccatcactccggtg
tacaatcgattcacaccaaagccgtacacaagttctgcccggccatttgaacgcaaattt
gaaagtccgaagttcaaccataatcttctgccaagtgaaactgtacataaacctgaattg
tcttcaaaaactcccacttccccaaaaactcttatgaaagctcatagttcaacacagcct
ccagagtttgacagtggagttgaaactttctctgttcacacagataagcctaaatatcaa
atgaataatatcagcaccatgcctaaagctgtccctgtgagtccttcagctgtggaagaa
gatgaagatgaggatggtcatactgtagtggctacagctcgtggcatttttaacagcaat
ggtggtgtgttgagttccatagaaaccggtgttagtataattatcccacaaggagccatt
cctgaaggaattgagcaagaaatctatttcaaagtctgcagagacaatagcattctccca
cctttagataaagagaaaggtgaaactctgctgagccccctagtgatgtgtgggccccat
ggcctcaagttcctgaagcccgtggagctacgcttgccacactgtgaccctaaaacctgg
caaaacaagtgtcttcctggagatccgaattaccttgttggagccaactgtgtttctgtc
ctgattgaccacttttaa

DBGET integrated database retrieval system