KEGG   Mus musculus (house mouse): 21938
Entry
21938             CDS       T01002                                 
Symbol
Tnfrsf1b, CD120b, TNF-R-II, TNF-R2, TNF-R75, TNF-alphaR2, TNFBR, TNFR80, TNFRII, TNFalpha-R2, Tnfr-1, Tnfr2, p75
Name
(RefSeq) tumor necrosis factor receptor superfamily, member 1b
  KO
K05141  tumor necrosis factor receptor superfamily member 1B
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04668  TNF signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu05014  Amyotrophic lateral sclerosis
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    21938 (Tnfrsf1b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21938 (Tnfrsf1b)
   04061 Viral protein interaction with cytokine and cytokine receptor
    21938 (Tnfrsf1b)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    21938 (Tnfrsf1b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    21938 (Tnfrsf1b)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    21938 (Tnfrsf1b)
   05022 Pathways of neurodegeneration - multiple diseases
    21938 (Tnfrsf1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    21938 (Tnfrsf1b)
   04090 CD molecules [BR:mmu04090]
    21938 (Tnfrsf1b)
Cytokine receptors [BR:mmu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   21938 (Tnfrsf1b)
CD molecules [BR:mmu04090]
 Proteins
  21938 (Tnfrsf1b)
SSDB
Motif
Pfam: TNFR_c6 Casein_kappa
Other DBs
NCBI-GeneID: 21938
NCBI-ProteinID: NP_035740
MGI: 1314883
Ensembl: ENSMUSG00000028599
UniProt: P25119 Q545P4
LinkDB
Position
4:complement(144938938..144973453)
AA seq 474 aa
MAPAALWVALVFELQLWATGHTVPAQVVLTPYKPEPGYECQISQEYYDRKAQMCCAKCPP
GQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCA
CEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDV
CRPHRICSILAIPGNASTDAVCAPESPTLSAIPRTLYVSQPEPTRSQPLDQEPGPSQTPS
ILTSLGSTPIIEQSTKGGISLPIGLIVGVTSLGLLMLGLVNCIILVQRKKKPSCLQRDAK
VPHVPDEKSQDAVGLEQQHLLTTAPSSSSSSLESSASAGDRRAPPGGHPQARVMAEAQGF
QEARASSRISDSSHGSHGTHVNVTCIVNVCSSSDHSSQCSSQASATVGDPDAKPSASPKD
EQVPFSQEECPSQSPCETTETLQSHEKPLPLGVPDMGMKPSQAGWFDQIAVKVA
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggcgcccgccgccctctgggtcgcgctggtcttcgaactgcagctgtgggccaccggg
cacacagtgcccgcccaggttgtcttgacaccctacaaaccggaacctgggtacgagtgc
cagatctcacaggaatactatgacaggaaggctcagatgtgctgtgctaagtgtcctcct
ggccaatatgtgaaacatttctgcaacaagacctcggacaccgtgtgtgcggactgtgag
gcaagcatgtatacccaggtctggaaccagtttcgtacatgtttgagctgcagttcttcc
tgtaccactgaccaggtggagatccgcgcctgcactaaacagcagaaccgagtgtgtgct
tgcgaagctggcaggtactgcgccttgaaaacccattctggcagctgtcgacagtgcatg
aggctgagcaagtgcggccctggcttcggagtggccagttcaagagccccaaatggaaat
gtgctatgcaaggcctgtgccccagggacgttctctgacaccacatcatccactgatgtg
tgcaggccccaccgcatctgtagcatcctggctattcccggaaatgcaagcacagatgca
gtctgtgcgcccgagtccccaactctaagtgccatcccaaggacactctacgtatctcag
ccagagcccacaagatcccaacccctggatcaagagccagggcccagccaaactccaagc
atccttacatcgttgggttcaacccccattattgaacaaagtaccaagggtggcatctct
cttccaattggtctgattgttggagtgacatcactgggtctgctgatgttaggactggtg
aactgcatcatcctggtgcagaggaaaaagaagccctcctgcctacaaagagatgccaag
gtgcctcatgtgcctgatgagaaatcccaggatgcagtaggccttgagcagcagcacctg
ttgaccacagcacccagttccagcagcagctccctagagagctcagccagcgctggggac
cgaagggcgccccctgggggccatccccaagcaagagtcatggcggaggcccaagggttt
caggaggcccgtgccagctccaggatttcagattcttcccacggaagccacgggacccac
gtcaacgtcacctgcatcgtgaacgtctgtagcagctctgaccacagttctcagtgctct
tcccaagccagcgccacagtgggagacccagatgccaagccctcagcgtccccaaaggat
gagcaggtccccttctctcaggaggagtgtccgtctcagtccccgtgtgagactacagag
acactgcagagccatgagaagcccttgccccttggtgtgccggatatgggcatgaagccc
agccaagctggctggtttgatcagattgcagtcaaagtggcctga

DBGET integrated database retrieval system