KEGG   Mus musculus (mouse): 22166Help
Entry
22166             CDS       T01002                                 

Gene name
Txn1, ADF, AW550880, Trx1, Txn
Definition
(RefSeq) thioredoxin 1
  KO
K03671  thioredoxin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    22166 (Txn1)
 09160 Human Diseases
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    22166 (Txn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    22166 (Txn1)
Chaperones and folding catalysts [BR:mmu03110]
 Protein folding catalysts
  Protein disulfide isomerase
   22166 (Txn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_7 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_9 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 22166
NCBI-ProteinID: NP_035790
MGI: 98874
Ensembl: ENSMUSG00000028367
Vega: OTTMUSG00000007384
UniProt: P10639
LinkDB All DBs
Position
4 B3; 4 31.87 cM
AA seq 105 aa AA seqDB search
MVKLIESKEAFQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLCDKYSNVVFLEVDVD
DCQDVAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEASITEYA
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagctgatcgagagcaaggaagcttttcaggaggccctggccgccgcgggagac
aagcttgtcgtggtggacttctctgctacgtggtgtggaccttgcaaaatgatcaagccc
ttcttccattccctctgtgacaagtattccaatgtggtgttccttgaagtggatgtggat
gactgccaggatgttgctgcagactgtgaagtcaaatgcatgccgaccttccagttttat
aaaaagggtcaaaaggtgggggagttctccggtgctaacaaggaaaagcttgaagcctct
attactgaatatgcctaa

DBGET integrated database retrieval system