Mus musculus (house mouse): 22166 Help Entry 22166             CDS       T01002                                  Symbol Txn1, ADF, Trx1, Txn Name (RefSeq) thioredoxin 1   KO K03671   thioredoxin Organism mmu  Mus musculus (house mouse) Pathway mmu04621   NOD-like receptor signaling pathway mmu05012   Parkinson disease mmu05132   Salmonella infection mmu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmu00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     22166 (Txn1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     22166 (Txn1)   09164 Neurodegenerative disease    05012 Parkinson disease     22166 (Txn1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     22166 (Txn1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mmu03110]     22166 (Txn1) Chaperones and folding catalysts [BR:mmu03110]  Protein folding catalysts   Protein disulfide isomerase    22166 (Txn1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 AhpC-TSA Thioredoxin_7 OST3_OST6 Thioredoxin_9 Glutaredoxin Motif Other DBs NCBI-GeneID:  22166 NCBI-ProteinID:  NP_035790 MGI:  98874 Ensembl:  ENSMUSG00000028367 UniProt:  P10639 LinkDB All DBs Position 4:complement(57943373..57956411) Genome browser AA seq 105 aa AA seqDB search MVKLIESKEAFQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLCDKYSNVVFLEVDVD DCQDVAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEASITEYA NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagctgatcgagagcaaggaagcttttcaggaggccctggccgccgcgggagac aagcttgtcgtggtggacttctctgctacgtggtgtggaccttgcaaaatgatcaagccc ttcttccattccctctgtgacaagtattccaatgtggtgttccttgaagtggatgtggat gactgccaggatgttgctgcagactgtgaagtcaaatgcatgccgaccttccagttttat aaaaagggtcaaaaggtgggggagttctccggtgctaacaaggaaaagcttgaagcctct attactgaatatgcctaa

DBGET integrated database retrieval system