KEGG   Mus musculus (house mouse): 22350
Entry
22350             CDS       T01002                                 
Symbol
Ezr, AW146364, R75297, Vil2, p81
Name
(RefSeq) ezrin
  KO
K08007  villin 2 (ezrin)
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu04971  Gastric acid secretion
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    22350 (Ezr)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    22350 (Ezr)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    22350 (Ezr)
  09154 Digestive system
   04971 Gastric acid secretion
    22350 (Ezr)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    22350 (Ezr)
   05205 Proteoglycans in cancer
    22350 (Ezr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    22350 (Ezr)
   04147 Exosome [BR:mmu04147]
    22350 (Ezr)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Gelsolin / villin
     22350 (Ezr)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   22350 (Ezr)
SSDB
Motif
Pfam: ERM_C ERM_helical FERM_C FERM_M FERM_N
Other DBs
NCBI-GeneID: 22350
NCBI-ProteinID: NP_033536
MGI: 98931
Ensembl: ENSMUSG00000052397
Vega: OTTMUSG00000018216
UniProt: P26040 Q4KML7 Q3UL48 Q8CBU4
LinkDB
Position
17:complement(7005530..7050179)
AA seq 586 aa
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYVDNKGFPTWLK
LDKKVSAQEVRKENPVQFKFRAKFYPEDVAEELIQDITQKLFFLQVKDGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKEMHKSGYLSSERLIPQRVMDQHKLSRDQWEDRIQVWHAEHR
GMLKDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMLREKEELMLRLQDYEQKTKR
AEKELSEQIEKALQLEEERRRAQEEAERLEADRMAALRAKEELERQAQDQIKSQEQLAAE
LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP
VNYHVQEGLQDEGAEPMGYSAELSSEGILDDRNEEKRITEAEKNERVQRQLLTLSNELSQ
ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAM
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgcccaagccaatcaacgtccgggtgaccaccatggatgccgagctggagtttgccatc
cagccaaacaccaccgggaagcagctctttgatcaggtggtaaagacgattggcctccgg
gaagtgtggtacttcggcctccagtatgtagacaataaaggatttcctacctggctgaaa
cttgataaaaaggtctccgcacaggaggtccgaaaggagaaccctgtccagtttaaattc
cgggccaagttctaccccgaagacgtggccgaggaactcatccaggacatcacacagaag
ctcttcttcctgcaagtcaaggacgggatcctcagcgacgagatctactgccccccagag
acagccgtgctcctgggctcctatgccgttcaggccaagttcggagattataacaaggaa
atgcacaagtctgggtacctcagctcggagcggctgatcccccagagagtcatggaccaa
cacaagctcagcagggaccagtgggaggaccggatccaggtgtggcacgcggaacaccga
gggatgctcaaggacagtgctatgctagaatacctgaagattgcccaggacctggaaatg
tatgggatcaactatttcgagatcaaaaacaagaaaggaacagacctttggcttggagtc
gatgcccttggacttaacatttatgagaaagatgacaagttgaccccaaagatcggcttc
ccttggagtgagatcaggaacatctctttcaacgacaagaagtttgtcattaagcccatc
gacaagaaggcacctgactttgtgttctacgccccgcgcctgagaattaacaagcggatc
ctgcagctctgcatggggaaccatgagctgtacatgcgccgcaggaagcccgacaccatc
gaggtgcagcagatgaaggcccaggctcgggaggagaagcaccagaagcagctagagcga
cagcagttggaaaccgagaagaagaggcgagagacggtggagagagaaaaggagcagatg
ctccgggagaaggaggagctgatgcttcggctgcaggactacgagcagaagaccaagagg
gcggagaaagagctctccgagcagattgagaaggccctccaactggaggaagagaggagg
cgagcccaggaggaggctgaacgtctggaggccgaccgcatggccgccctgcgggccaag
gaagaactcgagagacaggcgcaggatcagataaagagccaggagcagctggctgcagag
ctggcagagtacacggccaagatcgcactgctggaggaggcgcggaggcgcaaggaggac
gaggtagaagagtggcagcaccgggctaaagaagcccaggacgacctggtgaagaccaaa
gaggagctgcacctggtgatgacggccccaccgcccccaccgcccccagtgtatgagcct
gtgaattaccacgtgcaggagggactgcaggacgagggagcagagcctatgggctacagt
gccgagctctccagtgagggcatcctggatgaccgcaacgaggagaagcggatcacagag
gcagagaagaatgagcgcgtgcagcggcagctgctgaccctgagcaatgagttgtcccag
gcccgggatgagaacaagaggacccacaatgacatcatccacaacgagaacatgcggcaa
ggcagggacaagtataagacgctgcggcaaatcaggcagggcaacaccaagcaacgcatt
gacgagttcgaggccatgtag

DBGET integrated database retrieval system