KEGG   Mus musculus (house mouse): 225825
Entry
225825            CDS       T01002                                 
Symbol
Cd226, BC051526, DNAM-1, DNAM1, Pta1, TLiSA1
Name
(RefSeq) CD226 antigen
  KO
K06567  CD226 antigen
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    225825 (Cd226)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    225825 (Cd226)
CD molecules [BR:mmu04090]
 Proteins
  225825 (Cd226)
SSDB
Motif
Pfam: V-set Ig_3 Ig_2 ig I-set stn_TNFRSF12A LAX Adeno_E3_CR2 Syndecan TMEM154 BatA
Other DBs
NCBI-GeneID: 225825
NCBI-ProteinID: NP_848802
MGI: 3039602
Ensembl: ENSMUSG00000034028
UniProt: Q8K4F0 Q5DW69
Structure
LinkDB
Position
18:89195078..89290356
AA seq 333 aa
MAYVTWLLAILHVHKALCEETLWDTTVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVS
IAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWE
KKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASC
NLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRL
IITDGGTNKHFILPIVGGLVSLLLVILIIIIFILYNRKRRRQVRIPLKEPRDKQSKVATN
CRSPTSPIQSTDDEKEDIYVNYPTFSRRPKPRL
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggcttatgttacttggcttttggctattcttcatgtgcacaaagcactgtgtgaagag
acattgtgggacacaacagttcggctttctgagactatgactctggaatgtgtatatcca
ttgacgcataacttaacccaggtggagtggaccaagaacactggcacaaagacagtgagc
atagcagtttacaaccctaaccataatatgcatatagaatctaactacctccatagagta
cacttcctaaactcaacagtggggttccgcaacatgagcctttccttttacaatgcctca
gaagcagacattggcatctactcctgcttgtttcatgctttcccaaatggaccttgggaa
aagaagataaaagtagtctggtcagatagttttgagatagcagcaccctcggatagctac
ctgtctgcagaacctggacaagatgtcacactcacttgccagcttccaaggacttggcca
gtgcaacaagtcatatgggaaaaagtccagccccatcaggtagacatcttagcttcctgt
aacctatctcaagagacaagatacacttcaaagtacctaagacaaacaaggagcaactgt
agccaggggagcatgaagagcatcctcatcattccaaatgccatggccgctgactcagga
ctttacagatgtcgctcagaggccattacaggaaaaaacaagtcctttgtcataaggctg
atcataactgatggtggaaccaataaacattttatccttcccatcgttggagggttagtt
tcactgttacttgtcatcctaattatcatcattttcattttatataacaggaagagacgg
agacaggtgagaattccacttaaagagcccagggataaacagagtaaggtagccaccaac
tgcagaagtcctacttctcccatccagtctacagatgatgaaaaagaggacatttatgta
aactatccaactttctctcgaagaccaaaaccaagactctaa

DBGET integrated database retrieval system