KEGG   Mus musculus (house mouse): 237038
Entry
237038            CDS       T01002                                 
Symbol
Nox1, GP91-2, MOX1, NOH-1, NOH1, NOX1a, NOX1alpha, Nox-1
Name
(RefSeq) NADPH oxidase 1
  KO
K08008  NADPH oxidase 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04380  Osteoclast differentiation
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    237038 (Nox1)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    237038 (Nox1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    237038 (Nox1)
   05022 Pathways of neurodegeneration - multiple diseases
    237038 (Nox1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    237038 (Nox1)
   05418 Fluid shear stress and atherosclerosis
    237038 (Nox1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    237038 (Nox1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    237038 (Nox1)
Membrane trafficking [BR:mmu04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   NADPH oxidases
    237038 (Nox1)
SSDB
Motif
Pfam: NAD_binding_6 Ferric_reduct FAD_binding_8 NAD_binding_1 Tetraspanin FAD_binding_6 DUF6011
Other DBs
NCBI-GeneID: 237038
NCBI-ProteinID: NP_757340
MGI: 2450016
Ensembl: ENSMUSG00000031257
UniProt: Q8CIZ9
LinkDB
Position
X:complement(132987170..133038455)
AA seq 563 aa
MGNWLVNHWLSVLFLVSWLGLNIFLFVYAFLNYEKSDKYYYTREILGTALALARASALCL
NFNSMMILIPVCRNLLSFLRGTCSFCNRTLRKPLDHNLTFHKLVAYMICIFTVIHIIAHL
FNFERYRRSQQAMDGSLASVLSSLSHPEKEDSWLNPIQSPNMTVMYAAFTSIAGLTGVIA
TVALVLMVTSAMEFIRRNYFELFWYTHHLFIVYIICLGIHGLGGIVRGQTEESLGESHPH
NCSHSFHEWDDHKGSCRHPHFAGHPPESWKWILAPIAFYIFERILRFYRSQQKVVITKVV
MHPSNVLELQMRKRGFSMEVGQYIFVNCPSISFLEWHPFTLTSAPEEEFFSVHIRAAGDW
TRNLIRTFEQQHSPMPRIEVDGPFGTVSEDVFQYEVAVLVGAGIGVTPFASILKSIWYKF
QRADNKLKTQKIYFYWICRETGAFAWFNNLLNSLEQEMEELGKMDFLNYRLFLTGWDSNI
AGHAALNFDRATDILTGLKQKTSFGRPMWDNEFSRIATAHPKSAVGVFLCGPRTLAKSLR
KRCQRYSSLDPRKVQFYFNKETF
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgggaaactggctggttaaccactggctctcagttttgtttctggtttcctggttgggg
ctgaacatttttctgtttgtgtatgccttcctgaattatgagaagtctgacaagtactat
tacacgagagaaattcttgggactgccttggccttggccagagcatctgctctgtgcttg
aattttaacagcatgatgatcctgattcctgtgtgtcgaaatctgctgtccttcttgagg
ggcacctgctcattttgcaaccgtacactgagaaagccattggatcacaacctcaccttc
cataagctggtggcatatatgatctgcatattcacagttattcatatcattgcacaccta
tttaacttcgaacgctacagaagaagccaacaggccatggatggatctctcgcttctgtt
ctctccagcctatctcatcctgagaaagaagattcttggctaaatcccatccagtctcca
aacatgacagtgatgtatgcagcatttaccagtattgctggccttactggagtgattgcc
actgtagctttggttctcatggtaacgtcagctatggagtttatccgcaggaattatttt
gagctcttttggtatacacatcacctttttatcgtctatatcatctgcttagggatccat
ggcctgggtgggattgtccggggtcaaacagaggagagcttgggtgaaagccatcctcac
aattgttcccattcttttcacgagtgggatgaccataaggggagttgcaggcatcctcat
tttgcggggcacccccctgagtcttggaagtggatccttgcaccgattgctttttatata
tttgaaaggatccttcgcttttatcgctcccagcagaaggtcgtgattaccaaggttgtc
atgcacccatctaatgttttggaattgcagatgaggaagcgaggctttagcatggaagta
ggacagtatatatttgtaaattgcccctccatttccttcctggagtggcatcccttcact
ctgacttctgctccagaggaagaatttttctccgttcatattcgagcagcaggggactgg
acacgaaatctcataaggacatttgaacaacagcactcaccaatgcccaggatcgaggtg
gacggtccctttggcacagtcagtgaggatgttttccagtatgaagtggctgtactggtt
ggggcagggattggggtcactccctttgcttccatcttgaaatctatctggtacaaattc
cagcgtgccgacaacaagctcaaaacacaaaagatctatttctactggatctgtagagag
acaggtgcctttgcctggttcaacaacttattgaattccctggaacaagagatggaggaa
ttaggcaaaatggattttctaaactaccgtctcttcctcactggctgggatagcaacatt
gctggtcatgcagcattaaactttgacagagccactgacatcctgacaggtctgaagcag
aaaacttcctttgggagaccaatgtgggacaatgagttttctagaatagctactgcccac
cccaagtctgcggtgggggttttcttatgtggccctcggactttggcaaaaagcctgcgc
aaacgctgtcagcgatactcgagtctggatcctaggaaggttcagttctacttcaacaaa
gaaacgttctga

DBGET integrated database retrieval system