Mus musculus (house mouse): 23825 Help Entry 23825             CDS       T01002                                  Symbol Banf1, Baf, Bcrp1, L2bp1/Baf Name (RefSeq) BAF nuclear assembly factor 1   KO K21870   barrier-to-autointegration factor Organism mmu  Mus musculus (house mouse) Brite KEGG Orthology (KO) [BR:mmu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmu03036]     23825 (Banf1) Chromosome and associated proteins [BR:mmu03036]  Eukaryotic type   Histone modification proteins    Other histone modification proteins     23825 (Banf1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SAM_BAF IMS_HHH Motif Other DBs NCBI-GeneID:  23825 NCBI-ProteinID:  NP_001033320 MGI:  1346330 Ensembl:  ENSMUSG00000024844 UniProt:  O54962 LinkDB All DBs Position 19:complement(5414661..5416904) Genome browser AA seq 89 aa AA seqDB search MTTSQKHRDFVAEPMGEKPVGSLAGIGDVLSKRLEERGFDKAYVVLGQFLVLKKDEDLFR EWLKDTCGANAKQSRDCFGCLREWCDAFL NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgacaacctcccaaaagcaccgagacttcgtggcagagcccatgggggaaaagccagtg gggagcctggccgggattggtgacgtcctgagcaagaggctggaggaaaggggctttgac aaggcttatgtggtccttggccagtttctggtgctaaagaaagatgaagacctcttccga gaatggctgaaggatacatgtggtgccaatgccaagcagtcccgggactgctttgggtgc cttcgagaatggtgtgatgccttcttgtag

DBGET integrated database retrieval system