KEGG   Mus musculus (house mouse): 241568
Entry
241568            CDS       T01002                                 
Symbol
Lrrc4c, 6430556C10Rik, NGL-1
Name
(RefSeq) leucine rich repeat containing 4C
  KO
K07523  netrin-G1 ligand
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04360  Axon guidance
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    241568 (Lrrc4c)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    241568 (Lrrc4c)
SSDB
Motif
Pfam: LRR_8 LRR_5 LRR_4 I-set Ig_3 ig V-set LRR_9 Ig_2 LRR_1 LRRNT Ig_6 Herpes_gE_N Syndecan
Other DBs
NCBI-GeneID: 241568
NCBI-ProteinID: NP_001276671
MGI: 2442636
Ensembl: ENSMUSG00000050587
UniProt: Q8C031
LinkDB
Position
2:96148514..97466871
AA seq 640 aa
MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKV
ICVRKNLREVPDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAF
NGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLG
ELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQ
GLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHH
NPWNCNCDILWLSWWIRDMAPSNTACCARCNTPPNLKGRYIGELDQNYFTCYAPVIVEPP
ADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQD
TGMYTCMVSNSVGNTTASATLNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTP
VIDWETTNVTTSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMA
AVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNS
YKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgttgaacaagatgaccttacatccacagcagataatgataggtcctaggtttaacagg
gccctatttgaccccctgcttgtggtgctgttggctcttcaacttcttgtggtggctggt
ttggttcgtgctcaaacctgcccttcagtgtgctcttgtagcaaccagttcagcaaggtg
atttgtgttcggaaaaaccttcgtgaagttccggatggcatctccaccaacacaaggctg
ctgaacctccatgagaaccaaatccagatcattaaagtgaacagcttcaagcatttgagg
cacttagaaatcctccagttgagcaggaaccatattcgaaccattgaaatcggggccttc
aatggtctggccaacctcaacaccctggaactctttgacaatcgtcttactaccataccg
aatggagcttttgtatatttgtctaaactgaaggagctctggttgaggaacaaccctatt
gaaagcatcccttcctatgcttttaacagaatcccttctttgcgccgcctggacttaggg
gaattgaaaaggctttcatacatctcagaaggtgcctttgaaggtctgtccaacttgagg
tatttgaaccttgccatgtgcaaccttcgggaaatccctaacctcacaccactcatcaaa
cttgacgagctagatctttctgggaaccatttgtctgcaatcaggcctggctcttttcag
gggttgatgcaccttcaaaaactgtggatgatacagtctcagattcaagtgattgaacgg
aatgcctttgataaccttcagtcactagtggagataaacttggcacacaacaatctaaca
ttattgcctcatgacctcttcacacccttgcatcatctagagaggatacacctccatcac
aacccgtggaactgtaactgtgatatcctgtggctcagctggtggataagagacatggcc
ccctccaacacagcttgctgtgccaggtgtaacactccccccaacctgaaagggaggtac
atcggagagctggaccagaattactttacatgctatgctcccgtaattgtggagccccct
gcagacctcaatgtcactgaaggcatggcagctgagctgaaatgtcgggcttctacgtcc
ctgacttccgtatcttggattactccaaatggaacagtcatgacccacggggcatacaaa
gtgcggatagctgtgctcagcgacggtactttaaatttcacaaatgtaactgtgcaagac
acaggcatgtacacatgtatggtgagtaattctgttggcaacaccactgcttctgccacc
ttgaatgttactgcggcaaccactactccgttctcgtacttttcaactgtaacagtagag
actatggaaccttctcaggatgaggcacggaccacagataacaatgtgggccccactcca
gtgatcgattgggagaccaccaatgtaaccacatctcttacgccacagagcacaaggtcg
acagaaaaaacattcaccatcccagtaactgacatcaacagcggaatcccaggaattgat
gaggtcatgaaaacaactaaaatcattattgggtgttttgtggccatcacactcatggct
gccgtgatgctggtcattttctacaagatgaggaaacagcaccatcggcaaaaccaccat
gctccaacaaggactgttgaaatcattaacgtggatgatgagatcactggggacacgccc
atggaaagccacctgcccatgcctgcgattgagcatgagcacctaaaccactataactct
tacaaatctcccttcaaccacacaacaacagtaaacacaataaattcaatacacagttca
gtgcatgaaccgttattgatccgaatgaactctaaagacaatgtacaagagactcagata
taa

DBGET integrated database retrieval system