KEGG   Mus musculus (house mouse): 242122
Entry
242122            CDS       T01002                                 
Symbol
Vtcn1, B7h4, B7s1, B7x, BC032925
Name
(RefSeq) V-set domain containing T cell activation inhibitor 1
  KO
K06747  immune costimulatory protein B7-H4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    242122 (Vtcn1)
SSDB
Motif
Pfam: Ig_3 V-set I-set Ig_2 ig Ig_6 Peptidase_S78_2
Other DBs
NCBI-GeneID: 242122
NCBI-ProteinID: NP_848709
MGI: 3039619
Ensembl: ENSMUSG00000051076
UniProt: Q7TSP5
LinkDB
Position
3:100732765..100804238
AA seq 283 aa
MASLGQIIFWSIINIIIILAGAIALIIGFGISGKHFITVTTFTSAGNIGEDGTLSCTFEP
DIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNV
QLTDAGTYTCYIRTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVA
WASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKV
TDSEVKRRSQLQLLNSGPSPCVFSSAFVAGWALLSLSCCLMLR
NT seq 852 nt   +upstreamnt  +downstreamnt
atggcttccttggggcagatcatcttttggagtattattaacatcatcatcatcctggct
ggggccatcgcactcatcattggctttggcatttcaggcaagcacttcatcacggtcacg
accttcacctcagctggaaacattggagaggacgggaccctgagctgcacttttgaacct
gacatcaaactcaacggcatcgtcatccagtggctgaaagaaggcatcaaaggtttggtc
cacgagttcaaagaaggcaaagacgacctctcacagcagcatgagatgttcagaggccgc
acagcagtgtttgctgatcaggtggtagttggcaatgcttccctgagactgaaaaacgtg
cagctcacggatgctggcacctacacatgttacatccgcacctcaaaaggcaaagggaat
gcaaaccttgagtataagaccggagccttcagtatgccagagataaatgtggactataat
gccagttcagagagtttacgctgcgaggctcctcggtggttcccccagcccacagtggcc
tgggcatctcaagtcgaccaaggagccaatttctcagaagtctccaacaccagctttgag
ttgaactctgagaatgtgaccatgaaggtcgtatctgtgctctacaatgtcacaatcaac
aacacatactcctgtatgattgaaaacgacattgccaaagccaccggggacatcaaagtg
acagattcagaggtcaaaaggcgaagtcagctgcagttgctgaactctgggccttccccg
tgtgttttttcttctgcctttgtggctggctgggcactcctatctctctcctgttgcctg
atgctaagatga

DBGET integrated database retrieval system