KEGG   Mus musculus (house mouse): 26409
Entry
26409             CDS       T01002                                 
Symbol
Map3k7, B430101B05, C87327, Tak1
Name
(RefSeq) mitogen-activated protein kinase kinase kinase 7
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04140  Autophagy - animal
mmu04152  AMPK signaling pathway
mmu04310  Wnt signaling pathway
mmu04380  Osteoclast differentiation
mmu04520  Adherens junction
mmu04613  Neutrophil extracellular trap formation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04668  TNF signaling pathway
mmu04936  Alcoholic liver disease
mmu05132  Salmonella infection
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05145  Toxoplasmosis
mmu05161  Hepatitis B
mmu05162  Measles
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    26409 (Map3k7)
   04310 Wnt signaling pathway
    26409 (Map3k7)
   04064 NF-kappa B signaling pathway
    26409 (Map3k7)
   04668 TNF signaling pathway
    26409 (Map3k7)
   04152 AMPK signaling pathway
    26409 (Map3k7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    26409 (Map3k7)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    26409 (Map3k7)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    26409 (Map3k7)
   04620 Toll-like receptor signaling pathway
    26409 (Map3k7)
   04621 NOD-like receptor signaling pathway
    26409 (Map3k7)
   04622 RIG-I-like receptor signaling pathway
    26409 (Map3k7)
   04660 T cell receptor signaling pathway
    26409 (Map3k7)
   04657 IL-17 signaling pathway
    26409 (Map3k7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    26409 (Map3k7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    26409 (Map3k7)
   05161 Hepatitis B
    26409 (Map3k7)
   05171 Coronavirus disease - COVID-19
    26409 (Map3k7)
   05162 Measles
    26409 (Map3k7)
   05168 Herpes simplex virus 1 infection
    26409 (Map3k7)
   05169 Epstein-Barr virus infection
    26409 (Map3k7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    26409 (Map3k7)
   05135 Yersinia infection
    26409 (Map3k7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    26409 (Map3k7)
   05140 Leishmaniasis
    26409 (Map3k7)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    26409 (Map3k7)
   05418 Fluid shear stress and atherosclerosis
    26409 (Map3k7)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    26409 (Map3k7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    26409 (Map3k7)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     26409 (Map3k7)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: TKL group
  MLK family
   26409 (Map3k7)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 26409
NCBI-ProteinID: NP_766276
MGI: 1346877
Ensembl: ENSMUSG00000028284
UniProt: Q62073 Q543B5
LinkDB
Position
4:31963659..32023470
AA seq 579 aa
MSTASAASSSSSSSASEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIVATAGNGQPRRRSIQDLTVTG
TEPGQVSSRSSSPSVRMITTSGPTSEKPARSHPWTPDDSTDTNGSDNSIPMAYLTLDHQL
QPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRL
VQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgtcgacagcctccgccgcctcgtcctcctcctcgtcttctgccagtgagatgatcgaa
gcgccgtcgcaggtcctgaacttcgaagagatcgactacaaggagatcgaggtggaagag
gttgtcggaagaggagcttttggagtagtttgcaaagctaagtggagagcaaaagatgtc
gctattaaacagatagaaagtgagtctgagaggaaggctttcattgtggagctccggcag
ttgtcacgtgtgaaccatcctaacattgtcaagttgtatggagcctgcctgaatccagta
tgtcttgtgatggaatatgcagaggggggctcattgtataatgtgctgcatggtgctgaa
ccattgccttactacactgctgctcatgccatgagctggtgtttacagtgttcccaagga
gtggcttacctgcacagcatgcagcccaaagcgctgattcacagggacctcaagcctcca
aacttgctgctggttgcaggagggacagttctaaaaatctgcgattttggtacagcttgt
gacatccaaacacacatgaccaataataaagggagtgctgcttggatggcgcctgaagta
tttgaaggtagcaattacagtgaaaagtgtgatgtcttcagctggggtattatcctctgg
gaagtgataacacgccggaaacccttcgatgagatcggtggcccagctttcagaatcatg
tgggctgttcataatggcactcgaccaccactgatcaaaaatttacctaagcccattgag
agcttgatgacacgctgttggtctaaggacccatctcagcgcccttcaatggaggaaatt
gtgaaaataatgactcacttgatgcggtacttcccaggagcggatgagccgttacagtat
ccttgtcagtactctgatgaagggcagagcaactcagccaccagcacaggctcattcatg
gacattgcttctacaaataccagtaataaaagtgacacaaatatggaacaggttcctgcc
acaaacgacactattaaacgcttggagtcaaaacttttgaaaaaccaggcaaagcaacag
agtgaatctggacgcctgagcttgggagcctctcgtgggagcagtgtggagagcttgccc
cccacttccgagggcaagaggatgagtgctgacatgtctgaaatagaagccaggatcgtg
gcgactgcaggtaacgggcaaccaaggcgtagatccatccaagacttgactgttactggg
acagaacctggtcaggtgagcagccggtcatccagccctagtgtcagaatgatcactacc
tcaggaccaacctcagagaagccagctcgcagtcacccgtggacccctgatgattccaca
gataccaatggctcagataactccatcccaatggcgtatcttacactggatcaccagcta
cagcctctagcgccgtgcccaaactccaaagaatccatggcagtgttcgaacaacattgt
aaaatggcacaggagtatatgaaagttcaaaccgaaatcgcattgttactacagagaaag
caagaactagttgcagaattggaccaggatgaaaaggaccagcaaaatacatctcgtctg
gtacaggaacataaaaagcttttagatgaaaacaaaagcctttctacttattaccagcaa
tgcaaaaaacaactagaggtcatcagaagccaacagcagaaacgacaaggcacttcatga

DBGET integrated database retrieval system