| Entry |
|
| Symbol |
Mapk3, Erk-1, Erk1, Ert2, Esrk1, Mnk1, Mtap2k, Prkm3, p44, p44erk1, p44mapk
|
| Name |
(RefSeq) mitogen-activated protein kinase 3
|
| KO |
|
| Organism |
mmu Mus musculus (house mouse)
|
| Pathway |
| mmu01521 | EGFR tyrosine kinase inhibitor resistance |
| mmu04072 | Phospholipase D signaling pathway |
| mmu04261 | Adrenergic signaling in cardiomyocytes |
| mmu04270 | Vascular smooth muscle contraction |
| mmu04550 | Signaling pathways regulating pluripotency of stem cells |
| mmu04613 | Neutrophil extracellular trap formation |
| mmu04620 | Toll-like receptor signaling pathway |
| mmu04621 | NOD-like receptor signaling pathway |
| mmu04625 | C-type lectin receptor signaling pathway |
| mmu04650 | Natural killer cell mediated cytotoxicity |
| mmu04658 | Th1 and Th2 cell differentiation |
| mmu04660 | T cell receptor signaling pathway |
| mmu04662 | B cell receptor signaling pathway |
| mmu04664 | Fc epsilon RI signaling pathway |
| mmu04666 | Fc gamma R-mediated phagocytosis |
| mmu04723 | Retrograde endocannabinoid signaling |
| mmu04810 | Regulation of actin cytoskeleton |
| mmu04914 | Progesterone-mediated oocyte maturation |
| mmu04919 | Thyroid hormone signaling pathway |
| mmu04928 | Parathyroid hormone synthesis, secretion and action |
| mmu04933 | AGE-RAGE signaling pathway in diabetic complications |
| mmu04935 | Growth hormone synthesis, secretion and action |
| mmu04960 | Aldosterone-regulated sodium reabsorption |
| mmu05022 | Pathways of neurodegeneration - multiple diseases |
| mmu05163 | Human cytomegalovirus infection |
| mmu05166 | Human T-cell leukemia virus 1 infection |
| mmu05167 | Kaposi sarcoma-associated herpesvirus infection |
| mmu05170 | Human immunodeficiency virus 1 infection |
| mmu05207 | Chemical carcinogenesis - receptor activation |
| mmu05208 | Chemical carcinogenesis - reactive oxygen species |
| mmu05230 | Central carbon metabolism in cancer |
| mmu05235 | PD-L1 expression and PD-1 checkpoint pathway in cancer |
|
| Brite |
KEGG Orthology (KO) [BR:mmu00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
26417 (Mapk3)
04012 ErbB signaling pathway
26417 (Mapk3)
04014 Ras signaling pathway
26417 (Mapk3)
04015 Rap1 signaling pathway
26417 (Mapk3)
04350 TGF-beta signaling pathway
26417 (Mapk3)
04370 VEGF signaling pathway
26417 (Mapk3)
04371 Apelin signaling pathway
26417 (Mapk3)
04668 TNF signaling pathway
26417 (Mapk3)
04066 HIF-1 signaling pathway
26417 (Mapk3)
04068 FoxO signaling pathway
26417 (Mapk3)
04072 Phospholipase D signaling pathway
26417 (Mapk3)
04071 Sphingolipid signaling pathway
26417 (Mapk3)
04024 cAMP signaling pathway
26417 (Mapk3)
04022 cGMP-PKG signaling pathway
26417 (Mapk3)
04151 PI3K-Akt signaling pathway
26417 (Mapk3)
04150 mTOR signaling pathway
26417 (Mapk3)
09133 Signaling molecules and interaction
04517 IgSF CAM signaling
26417 (Mapk3)
09140 Cellular Processes
09141 Transport and catabolism
04140 Autophagy - animal
26417 (Mapk3)
04148 Efferocytosis
26417 (Mapk3)
09143 Cell growth and death
04114 Oocyte meiosis
26417 (Mapk3)
04210 Apoptosis
26417 (Mapk3)
04218 Cellular senescence
26417 (Mapk3)
09144 Cellular community - eukaryotes
04510 Focal adhesion
26417 (Mapk3)
04520 Adherens junction
26417 (Mapk3)
04540 Gap junction
26417 (Mapk3)
04550 Signaling pathways regulating pluripotency of stem cells
26417 (Mapk3)
09142 Cell motility
04810 Regulation of actin cytoskeleton
26417 (Mapk3)
09150 Organismal Systems
09151 Immune system
04611 Platelet activation
26417 (Mapk3)
04613 Neutrophil extracellular trap formation
26417 (Mapk3)
04620 Toll-like receptor signaling pathway
26417 (Mapk3)
04621 NOD-like receptor signaling pathway
26417 (Mapk3)
04625 C-type lectin receptor signaling pathway
26417 (Mapk3)
04650 Natural killer cell mediated cytotoxicity
26417 (Mapk3)
04660 T cell receptor signaling pathway
26417 (Mapk3)
04658 Th1 and Th2 cell differentiation
26417 (Mapk3)
04659 Th17 cell differentiation
26417 (Mapk3)
04657 IL-17 signaling pathway
26417 (Mapk3)
04662 B cell receptor signaling pathway
26417 (Mapk3)
04664 Fc epsilon RI signaling pathway
26417 (Mapk3)
04666 Fc gamma R-mediated phagocytosis
26417 (Mapk3)
04062 Chemokine signaling pathway
26417 (Mapk3)
09152 Endocrine system
04910 Insulin signaling pathway
26417 (Mapk3)
04929 GnRH secretion
26417 (Mapk3)
04912 GnRH signaling pathway
26417 (Mapk3)
04915 Estrogen signaling pathway
26417 (Mapk3)
04914 Progesterone-mediated oocyte maturation
26417 (Mapk3)
04917 Prolactin signaling pathway
26417 (Mapk3)
04921 Oxytocin signaling pathway
26417 (Mapk3)
04926 Relaxin signaling pathway
26417 (Mapk3)
04935 Growth hormone synthesis, secretion and action
26417 (Mapk3)
04919 Thyroid hormone signaling pathway
26417 (Mapk3)
04928 Parathyroid hormone synthesis, secretion and action
26417 (Mapk3)
04916 Melanogenesis
26417 (Mapk3)
09153 Circulatory system
04261 Adrenergic signaling in cardiomyocytes
26417 (Mapk3)
04270 Vascular smooth muscle contraction
26417 (Mapk3)
09155 Excretory system
04960 Aldosterone-regulated sodium reabsorption
26417 (Mapk3)
09156 Nervous system
04724 Glutamatergic synapse
26417 (Mapk3)
04725 Cholinergic synapse
26417 (Mapk3)
04726 Serotonergic synapse
26417 (Mapk3)
04720 Long-term potentiation
26417 (Mapk3)
04730 Long-term depression
26417 (Mapk3)
04723 Retrograde endocannabinoid signaling
26417 (Mapk3)
04722 Neurotrophin signaling pathway
26417 (Mapk3)
09158 Development and regeneration
04360 Axon guidance
26417 (Mapk3)
04380 Osteoclast differentiation
26417 (Mapk3)
09159 Environmental adaptation
04713 Circadian entrainment
26417 (Mapk3)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
26417 (Mapk3)
05206 MicroRNAs in cancer
26417 (Mapk3)
05205 Proteoglycans in cancer
26417 (Mapk3)
05207 Chemical carcinogenesis - receptor activation
26417 (Mapk3)
05208 Chemical carcinogenesis - reactive oxygen species
26417 (Mapk3)
05203 Viral carcinogenesis
26417 (Mapk3)
05230 Central carbon metabolism in cancer
26417 (Mapk3)
05231 Choline metabolism in cancer
26417 (Mapk3)
05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
26417 (Mapk3)
09162 Cancer: specific types
05210 Colorectal cancer
26417 (Mapk3)
05212 Pancreatic cancer
26417 (Mapk3)
05225 Hepatocellular carcinoma
26417 (Mapk3)
05226 Gastric cancer
26417 (Mapk3)
05214 Glioma
26417 (Mapk3)
05216 Thyroid cancer
26417 (Mapk3)
05221 Acute myeloid leukemia
26417 (Mapk3)
05220 Chronic myeloid leukemia
26417 (Mapk3)
05218 Melanoma
26417 (Mapk3)
05211 Renal cell carcinoma
26417 (Mapk3)
05219 Bladder cancer
26417 (Mapk3)
05215 Prostate cancer
26417 (Mapk3)
05213 Endometrial cancer
26417 (Mapk3)
05224 Breast cancer
26417 (Mapk3)
05223 Non-small cell lung cancer
26417 (Mapk3)
09172 Infectious disease: viral
05166 Human T-cell leukemia virus 1 infection
26417 (Mapk3)
05170 Human immunodeficiency virus 1 infection
26417 (Mapk3)
05161 Hepatitis B
26417 (Mapk3)
05160 Hepatitis C
26417 (Mapk3)
05171 Coronavirus disease - COVID-19
26417 (Mapk3)
05164 Influenza A
26417 (Mapk3)
05163 Human cytomegalovirus infection
26417 (Mapk3)
05167 Kaposi sarcoma-associated herpesvirus infection
26417 (Mapk3)
05165 Human papillomavirus infection
26417 (Mapk3)
09171 Infectious disease: bacterial
05132 Salmonella infection
26417 (Mapk3)
05135 Yersinia infection
26417 (Mapk3)
05133 Pertussis
26417 (Mapk3)
05152 Tuberculosis
26417 (Mapk3)
09174 Infectious disease: parasitic
05145 Toxoplasmosis
26417 (Mapk3)
05140 Leishmaniasis
26417 (Mapk3)
05142 Chagas disease
26417 (Mapk3)
09164 Neurodegenerative disease
05010 Alzheimer disease
26417 (Mapk3)
05020 Prion disease
26417 (Mapk3)
05022 Pathways of neurodegeneration - multiple diseases
26417 (Mapk3)
09165 Substance dependence
05034 Alcoholism
26417 (Mapk3)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
26417 (Mapk3)
09167 Endocrine and metabolic disease
04930 Type II diabetes mellitus
26417 (Mapk3)
04933 AGE-RAGE signaling pathway in diabetic complications
26417 (Mapk3)
04934 Cushing syndrome
26417 (Mapk3)
09176 Drug resistance: antineoplastic
01521 EGFR tyrosine kinase inhibitor resistance
26417 (Mapk3)
01524 Platinum drug resistance
26417 (Mapk3)
01522 Endocrine resistance
26417 (Mapk3)
09180 Brite Hierarchies
09181 Protein families: metabolism
01001 Protein kinases [BR:mmu01001]
26417 (Mapk3)
09182 Protein families: genetic information processing
03036 Chromosome and associated proteins [BR:mmu03036]
26417 (Mapk3)
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:mmu04147]
26417 (Mapk3)
Enzymes [BR:mmu01000]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.11 Protein-serine/threonine kinases
2.7.11.24 mitogen-activated protein kinase
26417 (Mapk3)
Protein kinases [BR:mmu01001]
Serine/threonine kinases: CMGC group
MAPK family [OT]
26417 (Mapk3)
Chromosome and associated proteins [BR:mmu03036]
Eukaryotic type
Centromeric chromatin formation proteins
SAC (spindle assembly checkpoint) factors
Protein kinases
26417 (Mapk3)
Exosome [BR:mmu04147]
Exosomal proteins
Exosomal proteins of haemopoietic cells (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
26417 (Mapk3)
|
| SSDB |
|
| Motif |
|
| Other DBs |
|
| LinkDB |
|
| Position |
7:126358798..126364988
|
| AA seq |
380 aa
MAAAAAAPGGGGGEPRGTAGVVPVVPGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSA
YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVY
IVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS
DSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER
LKELIFQETARFQPGAPEGP |
| NT seq |
1143 nt +upstreamnt +downstreamnt
atggcggcggcggcggcggctccggggggcgggggcggggagcccaggggaactgctggg
gtcgtcccggtggtccccggggaggtggaggtggtgaaggggcagccattcgatgtgggc
ccacgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagct
tatgaccacgtgcgcaagaccagagtggccatcaagaagatcagcccctttgagcatcaa
acctactgtcagcgcacgctgagggagatccagatcttgctgcgattccgccatgagaat
gttataggcatccgagacatcctcagagcgcccaccctggaagccatgagagatgtttac
attgttcaggacctcatggagacagacctgtacaagctgcttaaaagccagcagctgagc
aatgaccacatctgctacttcctctaccagatcctccggggcctcaagtatatacactca
gccaatgtgctgcaccgggacctgaagccttccaatctgcttatcaacaccacctgcgac
cttaagatctgtgattttggcctggcccggattgctgaccctgagcacgaccacactggc
tttctgacggagtatgtggccacacgctggtaccgagccccagagatcatgcttaattcc
aagggctacaccaaatccatcgacatctggtctgtgggctgcattctggctgagatgctc
tccaaccggcccatcttccccggcaagcactacctggaccagctcaaccacattctaggt
atcttgggttccccatcccaggaggaccttaattgcatcattaacatgaaggcccgaaac
tacctgcagtctctgccctcgaaaaccaaggtggcttgggccaagctctttcctaaatct
gactccaaagctcttgacctgctggaccggatgttaaccttcaacccaaacaagcgcatc
acagtagaggaagcgctggctcacccttacctggaacagtactacgatccgacagatgag
ccagtggccgaggagccattcaccttcgacatggagctggatgacctccccaaggagcgg
ctgaaggagttgatcttccaggagacagcccgcttccagccaggggcgccagagggcccc
taa |