KEGG   Mus musculus (house mouse): 30939
Entry
30939             CDS       T01002                                 
Symbol
Pttg1, AW555095, C87862, Pttg, Pttg3
Name
(RefSeq) pituitary tumor-transforming gene 1
  KO
K06635  securin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    30939 (Pttg1)
   04114 Oocyte meiosis
    30939 (Pttg1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    30939 (Pttg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    30939 (Pttg1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Securin
    30939 (Pttg1)
SSDB
Motif
Pfam: Securin
Other DBs
NCBI-GeneID: 30939
NCBI-ProteinID: NP_001124526
MGI: 1353578
Ensembl: ENSMUSG00000020415
UniProt: Q9CQJ7
LinkDB
Position
11:complement(43311071..43318290)
AA seq 199 aa
MATLIFVDKDNEEPGRRLASKDGLKLGTGVKALDGKLQVSTPRVGKVFNAPAVPKASRKA
LGTVNRVAEKPMKTGKPLQPKQPTLTGKKITEKSTKTQSSVPAPDDAYPEIEKFFPFNPL
DFESFDLPEEHQISLLPLNGVPLMTLNEERGLEKLLHLGPPSPLKTPFLSWESDPLYSPP
SALSTLDVELPPVCYDADI
NT seq 600 nt   +upstreamnt  +downstreamnt
atggctactcttatctttgttgataaggataatgaagaacccggccgccgtttggcatct
aaggatgggttgaagctgggcactggtgtcaaggccttagatgggaaattgcaggtttca
acgcctcgagtcggcaaagtgttcaatgctccagccgtgcctaaagccagcagaaaggct
ttggggacagtcaacagagttgccgaaaagcctatgaagactggcaaacccctccaacca
aaacagccgaccttgactgggaaaaagatcaccgagaagtctactaagacacaaagttct
gttcctgctcctgatgatgcctacccagaaatagaaaagttcttccctttcaatcctcta
gactttgagagttttgacctgcctgaggagcaccagatctcacttctccccttgaatggc
gtgcctctcatgaccctgaatgaagagagagggctggagaagctgctgcatctgggcccc
cctagccctctgaagacaccctttctatcatgggaatctgatccgctgtactctcctccc
agtgccctctccactctggatgttgaattgccgcctgtttgttacgatgcagatatttaa

DBGET integrated database retrieval system