Mus musculus (house mouse): 319163 Help Entry 319163            CDS       T01002                                  Symbol H2ac1, Hist1h2aa, Th2a Name (RefSeq) H2A clustered histone 1   KO K11251   histone H2A Organism mmu  Mus musculus (house mouse) Pathway mmu03082   ATP-dependent chromatin remodeling mmu04217   Necroptosis mmu04613   Neutrophil extracellular trap formation mmu05034   Alcoholism mmu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmu00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     319163 (H2ac1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     319163 (H2ac1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     319163 (H2ac1)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     319163 (H2ac1)   09165 Substance dependence    05034 Alcoholism     319163 (H2ac1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmu03036]     319163 (H2ac1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     319163 (H2ac1) Chromosome and associated proteins [BR:mmu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     319163 (H2ac1) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    319163 (H2ac1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF YihI Motif Other DBs NCBI-GeneID:  319163 NCBI-ProteinID:  NP_783589 MGI:  2448285 Ensembl:  ENSMUSG00000060081 UniProt:  Q8CGP4 Structure PDBPDBj LinkDB All DBs Position 13:24118420..24118896 Genome browser AA seq 129 aa AA seqDB search MSGPTKRGGKARAKVKSRSSRAGLQFPVGRVHRLLRQGNYAQRIGAGAPVYLAAVLEYLT AEVLELAGNAARDNKKTRITPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK TESHKSQTK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcctacaaagcggggtggcaaggctcgtgccaaggtcaagtctcgctcttcc agggcaggtttgcagtttcctgtgggtcgtgtgcaccggcttctccgccaagggaactac gcacaacgaattggggctggtgcaccagtgtatctggcggcagtgctagaatacttgaca gctgaggtcctggagctggcgggcaacgcagcccgggacaacaagaagacgcgcattact cctcgccacctgcagctggccatccgcaacgacgaggagctcaacaagttgcttggccgc gtgaccatcgcgcagggtggcgtcctgcccaacatccaggccgtgctgctgcccaagaag accgagagccacaagtcccagaccaagtga

DBGET integrated database retrieval system