Mus musculus (house mouse): 319168 Help Entry 319168            CDS       T01002                                  Symbol H2ac12, Hist1h2ah Name (RefSeq) H2A clustered histone 12   KO K11251   histone H2A Organism mmu  Mus musculus (house mouse) Pathway mmu03082   ATP-dependent chromatin remodeling mmu04217   Necroptosis mmu04613   Neutrophil extracellular trap formation mmu05034   Alcoholism mmu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmu00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     319168 (H2ac12)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     319168 (H2ac12)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     319168 (H2ac12)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     319168 (H2ac12)   09165 Substance dependence    05034 Alcoholism     319168 (H2ac12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmu03036]     319168 (H2ac12)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     319168 (H2ac12) Chromosome and associated proteins [BR:mmu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     319168 (H2ac12) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    319168 (H2ac12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  319168 NCBI-ProteinID:  NP_783590 MGI:  2448295 Ensembl:  ENSMUSG00000069302 UniProt:  Q8CGP6 A3KPD0 Structure PDBPDBj LinkDB All DBs Position 13:complement(22219292..22219813) Genome browser AA seq 128 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK TESHHKAK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggtaagcagggcggcaaggctcgcgccaaggccaagacccgctcctcc cgggccggcctgcagttccccgtgggccgcgtgcaccggctgctccgcaagggcaactac tcggagcgcgtgggcgccggcgccccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc gtgaccatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag accgagagccaccacaaggccaagtga

DBGET integrated database retrieval system