Mus musculus (house mouse): 319170 Help Entry 319170            CDS       T01002                                  Symbol H2ac22, Hist1h2an Name (RefSeq) H2A clustered histone 22   KO K11251   histone H2A Organism mmu  Mus musculus (house mouse) Pathway mmu03082   ATP-dependent chromatin remodeling mmu04217   Necroptosis mmu04613   Neutrophil extracellular trap formation mmu05034   Alcoholism mmu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmu00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     319170 (H2ac22)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     319170 (H2ac22)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     319170 (H2ac22)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     319170 (H2ac22)   09165 Substance dependence    05034 Alcoholism     319170 (H2ac22)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmu03036]     319170 (H2ac22)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     319170 (H2ac22) Chromosome and associated proteins [BR:mmu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     319170 (H2ac22) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    319170 (H2ac22) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  319170 NCBI-ProteinID:  NP_835491 MGI:  2448300 Ensembl:  ENSMUSG00000069309 UniProt:  C0HKE1 C0HKE2 C0HKE3 C0HKE4 C0HKE5 C0HKE6 C0HKE7 C0HKE8 C0HKE9 B2RVF0 Structure PDBPDBj LinkDB All DBs Position 13:complement(21970944..21971418) Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggcaaacagggcggcaaggctcgcgccaaggccaagacccgctcctcc cgggccggcctgcagttccccgtgggccgcgtgcaccggctgctccgcaagggcaactac tcggagcgcgtgggcgccggcgccccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc gtgaccatcgcgcagggcggcgtcctgcccaacatccaggccgtactgctgccgaagaag accgagagccaccacaaggccaagggaaaataa

DBGET integrated database retrieval system