Mus musculus (house mouse): 319181 Help Entry 319181            CDS       T01002                                  Symbol H2bc8, H2bc4, H2bc6, Hist1h2bg Name (RefSeq) H2B clustered histone 8   KO K11252   histone H2B Organism mmu  Mus musculus (house mouse) Pathway mmu04613   Neutrophil extracellular trap formation mmu05034   Alcoholism mmu05203   Viral carcinogenesis mmu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     319181 (H2bc8)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     319181 (H2bc8)   09163 Immune disease    05322 Systemic lupus erythematosus     319181 (H2bc8)   09165 Substance dependence    05034 Alcoholism     319181 (H2bc8)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmu03036]     319181 (H2bc8)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     319181 (H2bc8) Chromosome and associated proteins [BR:mmu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     319181 (H2bc8) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    319181 (H2bc8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  319181 NCBI-ProteinID:  NP_835503 MGI:  2448386 Ensembl:  ENSMUSG00000058385 UniProt:  Q6ZWY9 Structure PDBPDBj LinkDB All DBs Position 13:23755574..23756037 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcccgagcctgcgaagtccgctcctgccccgaagaagggctccaagaaggccgtgacc aaggcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaagtgcaccccgacaccggcatctcctccaaggccatg ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcccgc ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtcggagggcaccaaggctgtcact aagtacaccagctccaagtga

DBGET integrated database retrieval system