Mus musculus (house mouse): 319186 Help Entry 319186            CDS       T01002                                  Symbol H2bc14, H2b-291b, Hist1h2bm Name (RefSeq) histone H2B type 1-M   KO K11252   histone H2B Organism mmu  Mus musculus (house mouse) Pathway mmu04613   Neutrophil extracellular trap formation mmu05034   Alcoholism mmu05203   Viral carcinogenesis mmu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     319186 (H2bc14)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     319186 (H2bc14)   09163 Immune disease    05322 Systemic lupus erythematosus     319186 (H2bc14)   09165 Substance dependence    05034 Alcoholism     319186 (H2bc14)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmu03036]     319186 (H2bc14)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     319186 (H2bc14) Chromosome and associated proteins [BR:mmu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     319186 (H2bc14) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    319186 (H2bc14) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Histone_ABTB CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  319186 NCBI-ProteinID:  NP_835507 MGI:  2448404 Ensembl:  ENSMUSG00000114279 UniProt:  P10854 B2RTK3 LinkDB All DBs Position 13:21906214..21906696 Genome browser AA seq 126 aa AA seqDB search MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccaacgaagtccgctcccgccccgaagaagggctccaagaaggccgtcacc aaggcccagaagaaggatggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctaaagcaagtgcaccccgacaccggcatctcctccaaggccatg ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcaggcgaggcttcccgc ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgcggtgtcggagggcaccaaggcggtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system