Mus musculus (house mouse): 319189 Help Entry 319189            CDS       T01002                                  Symbol H2bc18, H2b-616, Hist2h2bb Name (RefSeq) H2B clustered histone 18   KO K11252   histone H2B Organism mmu  Mus musculus (house mouse) Pathway mmu04613   Neutrophil extracellular trap formation mmu05034   Alcoholism mmu05203   Viral carcinogenesis mmu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     319189 (H2bc18)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     319189 (H2bc18)   09163 Immune disease    05322 Systemic lupus erythematosus     319189 (H2bc18)   09165 Substance dependence    05034 Alcoholism     319189 (H2bc18)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmu03036]     319189 (H2bc18)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     319189 (H2bc18) Chromosome and associated proteins [BR:mmu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     319189 (H2bc18) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    319189 (H2bc18) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like Motif Other DBs NCBI-GeneID:  319189 NCBI-ProteinID:  NP_783597 MGI:  2448413 Ensembl:  ENSMUSG00000105827 UniProt:  Q64525 LinkDB All DBs Position 3:96177016..96177508 Genome browser AA seq 126 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggatccagcgaagtctgctcctgccccaaagaagggctctaagaaagctgtcacg aaagtgcagaagaaagatggcaagaagcgcaagcgcagccgcaaggagagctattctgtt tacgtgtacaaggtcctgaagcaagtgcaccccgacacgggcatctcatctaaggctatg ggaatcatgaattccttcgtgaacgatatcttcgagcgcatcgcaggtgaggcttcccgt ctggcgcattacaacaagcgctcgaccatcacttcccgggagatccagacagccgtgcgt ctgctgctgccgggagagttggctaaacacgctgtgtcggaaggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system