Mus musculus (house mouse): 382562 Help Entry 382562            CDS       T01002                                  Symbol Pfn4, 2900024P18Rik Name (RefSeq) profilin family, member 4   KO K05759   profilin Organism mmu  Mus musculus (house mouse) Pathway mmu04015   Rap1 signaling pathway mmu04810   Regulation of actin cytoskeleton mmu05014   Amyotrophic lateral sclerosis mmu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     382562 (Pfn4)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     382562 (Pfn4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmu04131]     382562 (Pfn4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mmu04812]     382562 (Pfn4)    04147 Exosome [BR:mmu04147]     382562 (Pfn4) Membrane trafficking [BR:mmu04131]  Others   Actin-binding proteins    Others     382562 (Pfn4) Cytoskeleton proteins [BR:mmu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      382562 (Pfn4) Exosome [BR:mmu04147]  Exosomal proteins   Proteins found in most exosomes    382562 (Pfn4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  382562 NCBI-ProteinID:  NP_082652 MGI:  1920121 Ensembl:  ENSMUSG00000020639 UniProt:  Q9D6I3 LinkDB All DBs Position 12:4819010..4828813 Genome browser AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQEKTLCVTSPGFSVMPSDVRTLLNGFAKNPLLTR REGLYFKEKDYKCVRADDYSLYAKNENTGVVVVKTNMYLVVATYTAGMYPSVCVEATEKL GEYLRKKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagtcacttgcagaacttactgttagataccctgctggggacgaaacacgtggacagc gcagccctcatcaaactccaggaaaagaccctgtgtgtgacatcaccaggatttagtgta atgccaagtgatgttcgaacacttctgaatggatttgccaaaaacccattattaacgcga agggaagggttgtatttcaaggagaaggattacaaatgtgttcgggcagatgactattct ctctatgctaagaatgagaacactggtgtggtggtggtgaagaccaacatgtatcttgtg gtggcaacttacactgcaggcatgtatcctagcgtctgcgtggaagccacagagaagctg ggagagtatctaaggaaaaagggaaactaa

DBGET integrated database retrieval system