Mus musculus (house mouse): 385454 Help Entry 385454            CDS       T01002                                  Symbol Gm5396, EG385454 Name (RefSeq) predicted pseudogene 5396   KO K10802   high mobility group protein B1 Organism mmu  Mus musculus (house mouse) Pathway mmu03410   Base excision repair mmu04140   Autophagy - animal mmu04217   Necroptosis mmu04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:mmu00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     385454 (Gm5396)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     385454 (Gm5396)   09143 Cell growth and death    04217 Necroptosis     385454 (Gm5396)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     385454 (Gm5396)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmu03036]     385454 (Gm5396)    03400 DNA repair and recombination proteins [BR:mmu03400]     385454 (Gm5396)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     385454 (Gm5396) Chromosome and associated proteins [BR:mmu03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     385454 (Gm5396) DNA repair and recombination proteins [BR:mmu03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      385454 (Gm5396)    MMR (mismatch excision repair)     Other MMR factors      385454 (Gm5396) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    385454 (Gm5396) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box HMG_box_2 HMG_WDHD1 RNA_pol_3_Rpc31 Nop14 HMG_box_5 NOA36 Motif Other DBs NCBI-GeneID:  385454 NCBI-ProteinID:  XP_036018032 MGI:  3646589 Ensembl:  ENSMUSG00000084275 LinkDB All DBs Position X:complement(151895892..151896458) Genome browser AA seq 188 aa AA seqDB search MSKGEEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGNFEDMAKADKARYEREMKTYIP HKGETKKKFKDPNAPKRPPLAFLFCSEYCPKITGKHPGLSIGDLAKKLGKMWHNTAADDK QPYEKKAAKLKEKYEKGIAAHGAKGEPDAAKKGVVKAEKSKKKKEEEDGEEDEEDEEEEE EDIGDDDG NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgagcaaaggagaggagcacaagaagaagcacccggatgcttctgtcaacttctcagag ttctccaaaaagtgctcagagaggtggaagaccatgtctgctaaagaaaaggggaatttt gaagatatggcaaaggctgacaaggctcgttatgaaagagaaatgaaaacctacatccct cacaaaggggagaccaaaaagaagttcaaggaccctaatgcacccaagaggcctcctttg gccttcttgttctgttctgagtactgccccaaaatcacaggcaagcatcctggcttatcc attggtgatcttgcaaagaaactaggaaagatgtggcacaacactgcagcggatgacaag cagccctatgagaagaaggctgctaagctgaaggagaagtacgagaagggtattgctgcc cacggagctaaaggagaacctgatgcagcgaaaaagggggtggtcaaggctgaaaagagc aagaaaaagaaggaagaggaagatggtgaggaggatgaagaggatgaggaagaggaggaa gaagatataggtgatgatgatggataa

DBGET integrated database retrieval system