KEGG   Mus musculus (house mouse): 52118
Entry
52118             CDS       T01002                                 
Symbol
Pvr, 3830421F03Rik, CD155, D7Ertd458e, HVED, PVS, Taa1, Tage4, mE4, necl-5
Name
(RefSeq) poliovirus receptor
  KO
K06539  poliovirus receptor
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    52118 (Pvr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    52118 (Pvr)
   04090 CD molecules [BR:mmu04090]
    52118 (Pvr)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  Necl family
   52118 (Pvr)
CD molecules [BR:mmu04090]
 Proteins
  52118 (Pvr)
SSDB
Motif
Pfam: V-set C2-set_2 Ig_3 ig Ig_2 I-set C1-set DUF6377
Other DBs
NCBI-GeneID: 52118
NCBI-ProteinID: NP_081790
MGI: 107741
Ensembl: ENSMUSG00000040511
UniProt: Q8K094
LinkDB
Position
7:complement(19637503..19655068)
AA seq 408 aa
MAQLARATRSPLSWLLLLFCYALRKAGGDIRVLVPYNSTGVLGGSTTLHCSLTSNENVTI
TQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGI
YECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWP
SNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQ
PYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTNTGDFPNSVKRQGNML
LISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHLGYIFLIVFVLAV
VIIIAALYTIRRCRHGRALQSNPSERENVQYSSVNGDCRLNMEPNSTR
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggctcaactcgcccgagccacccgctccccgctgtcatggctgctgctgctgttctgc
tatgcactccggaaagcgggtggggatatacgtgtgctggtgccctacaattcgacaggc
gtcttgggagggtcgaccaccttgcactgtagtctgacttctaatgagaatgtgactatc
actcaaataacctggatgaagaaggattcaggtggatcccacgctcttgtggctgtcttc
caccccaagaaggggcccaacatcaaagagccagagagggtgaaattcttggctgcccaa
caggatctgaggaacgcatctctggccatctcgaacttaagtgtagaagacgaaggcatc
tatgaatgtcagattgccacattccccagaggcagtagaagcaccaatgcctggctgaag
gtgcaagcccgacctaagaacactgcagaggccctggagccctctcccaccttgatactg
caggatgtggctaaatgcatctctgccaatggtcaccctcctggacgaatctcttggccc
tcgaatgtgaatggaagtcaccgtgaaatgaaggaaccagggtcccagccgggcaccacc
acagttaccagctacctctccatggtaccttctcgccaggcagacggcaagaacatcacc
tgcacggtggagcatgaaagcttacaggagctggaccagctgctggtgaccctttcccaa
ccctatccacctgaaaacgtgtccatctctggctatgacggcaactggtatgttggcctc
actaacttgaccctgacctgtgaagctcacagcaaaccagcgcctgacatggctggatat
aactggagcacgaacacgggtgactttcccaactctgttaagcgccagggcaatatgctt
ctaatctccaccgtagaggatggtctcaataacacggtcattgtgtgcgaagtcaccaat
gccctagggtctgggcagggccaagtgcacatcattgttaaagagaaacctgagaatatg
cagcaaaatacaagattacacctaggctacatctttcttatcgtctttgtcctcgctgta
gtcatcatcatcgcagcactatacactatacgaagatgcaggcatggtcgtgctctgcag
tccaatccctcagagagggagaacgtccagtattcatctgtgaacggcgactgtagactg
aacatggagccaaacagcacaaggtga

DBGET integrated database retrieval system