Mus musculus (house mouse): 54420 Help Entry 54420             CDS       T01002                                  Symbol Cldn8 Name (RefSeq) claudin 8   KO K06087   claudin Organism mmu  Mus musculus (house mouse) Pathway mmu03272   Virion - Hepatitis viruses mmu04382   Cornified envelope formation mmu04514   Cell adhesion molecule (CAM) interaction mmu04530   Tight junction mmu04670   Leukocyte transendothelial migration mmu05160   Hepatitis C Brite KEGG Orthology (KO) [BR:mmu00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     54420 (Cldn8)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     54420 (Cldn8)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     54420 (Cldn8)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     54420 (Cldn8)   09158 Development and regeneration    04382 Cornified envelope formation     54420 (Cldn8)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     54420 (Cldn8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mmu03037]     54420 (Cldn8)    04147 Exosome [BR:mmu04147]     54420 (Cldn8) Cilium and associated proteins [BR:mmu03037]  Other cilia and associated proteins   Stereociliary proteins    54420 (Cldn8) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    54420 (Cldn8)   Exosomal proteins of colorectal cancer cells    54420 (Cldn8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF6338 Clc-like TMEM_230_134 Motif Other DBs NCBI-GeneID:  54420 NCBI-ProteinID:  NP_061248 MGI:  1859286 Ensembl:  ENSMUSG00000050520 UniProt:  Q9Z260 Q3UZK2 LinkDB All DBs Position 16:complement(88357714..88360071) Genome browser AA seq 225 aa AA seqDB search MATYALQMAALVLGGVGMVGTVAVTIMPQWRVSAFIESNIVVFENRWEGLWMNCMRHANI RMQCKVYDSLLALSPDLQASRGLMCAASVLAFLAFMTAILGMKCTRCTGDDENVKSRILL TAGIIFFITGLVVLIPVSWVANSIIRDFYNPLVDVALKRELGEALYIGWTTALVLIAGGA LFCCVFCCTERSNSYRYSVPSHRTTQRSFHAEKRSPSIYSKSQYV NT seq 678 nt NT seq  +upstreamnt  +downstreamnt atggcaacctacgctcttcaaatggctgcactggtgcttggtggtgttggcatggtgggc acggtggctgtgactatcatgcctcagtggagagtgtctgccttcatcgaaagtaacatt gtggtgtttgagaaccgctgggaaggcttgtggatgaattgtatgaggcatgccaacatc agaatgcagtgcaaggtctacgactccctgctggctcttagtccagacctccaggcatcc cgaggactgatgtgtgctgcgtccgtcttggctttcttggctttcatgacagccatcctc ggaatgaagtgcaccagatgcacgggggacgatgagaacgtgaagagccgcatcttgctg acagccggaatcatcttcttcatcaccggcttggttgtgctcatccctgtcagctgggtt gccaattccatcatcagagacttctacaacccactggtggatgtggccctaaagcgcgag ctgggagaagccctctacataggctggaccacagcgctggtgctgatcgctggaggagca ctgttctgttgtgtgttttgttgtactgaaaggagcaacagttacaggtactcggtacca tcccatcgcaccactcaacggagtttccacgccgaaaagagatctccgagcatatactcc aaaagtcagtatgtgtag

DBGET integrated database retrieval system