KEGG   Mus musculus (house mouse): 54725
Entry
54725             CDS       T01002                                 
Symbol
Cadm1, 2900073G06Rik, 3100001I08Rik, AI987920, Bl2, Igsf4, Igsf4a, Necl2, RA175, RA175A, RA175B, RA175C, RA175N, ST17, SgIGSF, SynCam, Tslc1
Name
(RefSeq) cell adhesion molecule 1
  KO
K06781  cell adhesion molecule 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    54725 (Cadm1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    54725 (Cadm1)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  Necl family
   54725 (Cadm1)
SSDB
Motif
Pfam: Ig_3 Ig_2 I-set ig V-set C2-set_2 C1-set Ig_C17orf99 Syndecan Mid2 Adhes-Ig_like
Other DBs
NCBI-GeneID: 54725
NCBI-ProteinID: NP_997558
MGI: 1889272
Ensembl: ENSMUSG00000032076
UniProt: Q8R5M8
LinkDB
Position
9:47441468..47773578
AA seq 456 aa
MASAVLPSGSQCAAAAAVAAAAAPPGLRLRLLLLLLSAAALIPTGDGQNLFTKDVTVIEG
EVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSIS
DEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTI
RWFKGNKELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYL
EVQYKPQVHIQMTYPLQGLTREGDAFELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPN
LFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPPTTTTTTTTTTTTTILTI
ITDTTATTEPAVHDSRAGEEGTIGAVDHAVIGGVVAVVVFAMLCLLIILGRYFARHKGTY
FTHEAKGADDAADADTAIINAEGGQNNSEEKKEYFI
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggcgagtgctgtgctgccgagcggatcccagtgtgcggcggcagcggctgtggcggcg
gcggcggcgcctccagggctccggctccggctcctgctgttgctcctttcggccgcggca
ctgatccccacaggtgatggacagaatctgtttactaaagacgtgacagtgattgaagga
gaagtggcaaccatcagctgccaggtcaataagagtgacgactcagtgatccagctcctg
aaccccaacaggcagaccatttacttcagggacttcaggcctttgaaggacagcaggttt
cagctgctgaatttttctagcagtgaactcaaagtgtcactgacgaatgtctcaatctcg
gatgaagggagatacttctgccagctctacacggaccccccacaggagagttacaccacc
atcacagtcctggttcctccacgtaacttgatgatcgatatccagaaagacacggcagtt
gaaggggaggagattgaagtcaactgtactgccatggccagcaagccagcgacgaccatc
aggtggttcaaagggaacaaggaactcaaaggcaaatcagaggtggaggagtggtcggac
atgtacactgtgaccagtcagctgatgctgaaggtgcacaaggaggacgacggggtcccg
gtgatctgccaggtggagcaccctgcggtcactggaaacctgcagacccagcgctatcta
gaagtgcagtataaaccgcaagtgcatatccagatgacttaccctctgcaaggcctaacc
cgggaaggggatgcatttgagttaacgtgtgaagccatcgggaagccccagcctgtgatg
gtaacttgggtgagagtcgatgatgaaatgcctcaacatgccgtactgtctgggccaaac
ctgttcatcaataacctaaacaaaacagataacggtacttaccgctgtgaggcttccaac
atagtgggaaaggctcattcggactatatgctgtatgtatacgatccccccacaactatc
cctcctcccacaacaaccaccaccactaccaccaccaccaccaccaccatccttaccatc
atcacagacaccacggcgacgacagaaccagcagttcacgattctcgagcaggtgaagag
gggaccattggggcagtggaccacgcagtgattggtggcgtcgtagccgtggtggtgttt
gccatgctatgcttgctcatcattctgggccgctattttgccagacataaaggtacatac
ttcactcatgaagccaaaggagccgatgacgcagcagacgcagacacagctataatcaat
gcagaaggaggacagaacaactccgaagaaaagaaagagtacttcatctag

DBGET integrated database retrieval system