Mus musculus (house mouse): 57255 Help Entry 57255             CDS       T01002                                  Symbol Cldn13, 2500004B14Rik Name (RefSeq) claudin 13   KO K06087   claudin Organism mmu  Mus musculus (house mouse) Pathway mmu03272   Virion - Hepatitis viruses mmu04382   Cornified envelope formation mmu04514   Cell adhesion molecule (CAM) interaction mmu04530   Tight junction mmu04670   Leukocyte transendothelial migration mmu05160   Hepatitis C Brite KEGG Orthology (KO) [BR:mmu00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     57255 (Cldn13)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     57255 (Cldn13)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     57255 (Cldn13)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     57255 (Cldn13)   09158 Development and regeneration    04382 Cornified envelope formation     57255 (Cldn13)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     57255 (Cldn13)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mmu03037]     57255 (Cldn13)    04147 Exosome [BR:mmu04147]     57255 (Cldn13) Cilium and associated proteins [BR:mmu03037]  Other cilia and associated proteins   Stereociliary proteins    57255 (Cldn13) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    57255 (Cldn13)   Exosomal proteins of colorectal cancer cells    57255 (Cldn13) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 PIRT Motif Other DBs NCBI-GeneID:  57255 NCBI-ProteinID:  NP_065250 MGI:  1913102 Ensembl:  ENSMUSG00000008843 UniProt:  Q9Z0S4 Q547B2 LinkDB All DBs Position 5:complement(134943104..134944384) Genome browser AA seq 211 aa AA seqDB search MVVSKQEAISFSVTSLGWVGAIVSCVLPVWRVTFPDDETDPDATIWEGLWHICQVRENRW IQCTLYDTRILVAQDIKVSRVFMVICTIGTWLGLLLCVLGDWRINCFMNFTIEENLLKVA GGMFLSVGLLMLVPLSWVTHNIIHGFFNPLLGFSKKVQMGSSLSLAWTSSLLLLLGGILL CVNIPVCRDFPRCIETPSARPSGANNDTLDV NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggtcgtcagcaaacaagaggccatcagcttctctgtgacttcactgggttgggtgggt gccattgtgagctgcgtgctgcccgtttggagggtgacctttccagatgatgagacagac ccagatgccaccatttgggagggtctgtggcacatatgccaggttcgggaaaacaggtgg atacagtgtacactgtatgacacccggatactggtagcacaggacataaaagtgtctcga gtctttatggtcatctgtaccattggaacctggctgggattgctgctctgtgtgcttggg gattggcgcatcaattgtttcatgaattttactattgaagagaacctcttgaaagtagcc ggtgggatgtttcttagtgttggccttctgatgctggtacccctgtcctgggtaacacac aacatcatccatggcttctttaacccattgcttggcttctcgaagaaagtacagatgggc tcttcactctccctggcctggaccagctccctgctgctgttgctgggaggcatcctgctc tgtgtcaacatcccagtatgcagagactttccccgttgcattgagacccctagtgctaga ccttcaggagccaacaacgataccttagatgtttga

DBGET integrated database retrieval system