KEGG   Mus musculus (house mouse): 58235
Entry
58235             CDS       T01002                                 
Symbol
Nectin1, AI835281, AW549174, Cd111, HIgR, HveC, PRR, PRR1, Pvrl1, nectin-1
Name
(RefSeq) nectin cell adhesion molecule 1
  KO
K06081  poliovirus receptor-related protein 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04520  Adherens junction
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    58235 (Nectin1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    58235 (Nectin1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    58235 (Nectin1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    58235 (Nectin1)
   04090 CD molecules [BR:mmu04090]
    58235 (Nectin1)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  Nectin family
   58235 (Nectin1)
CD molecules [BR:mmu04090]
 Proteins
  58235 (Nectin1)
SSDB
Motif
Pfam: C2-set_2 V-set Ig_3 Ig_2 ig I-set
Other DBs
NCBI-GeneID: 58235
NCBI-ProteinID: NP_067399
MGI: 1926483
Ensembl: ENSMUSG00000032012
UniProt: Q9JKF6
Structure
LinkDB
Position
9:43655251..43718758
AA seq 515 aa
MARMGLAGAAGRWWGLALGLTAFFLPGTHTQVVQVNDSMYGFIGTDVVLHCSFANPLPSV
KITQVTWQKASNGSKQNMAIYNPTMGVSVLPPYEKRVEFLRPSFIDGTIRLSGLELEDEG
MYICEFATFPTGNRESQLNLTVMAKPTNWIEGTRAVLRARKGQDDKVLVATCTSANGKPP
SAVSWETRLKGEAEYQEIRNPNGTVTVISRYRLVPSREAHRQSLACIVNYHLDRFRESLT
LNVQYEPEVTIEGFDGNWYLQRTDVKLTCKADANPPATEYHWTTLNGSLPKGVEAQNRTL
FFRGPITYSLAGTYICEATNPIGTRSGQVEVNITEFPYTPTPEHGRRAGQMPTAIIGGVA
GSVLLVLIVVGGIIVALRRRRHTFKGDYSTKKHVYGNGYSKAGIPQHHPPMAQNLQYPDD
SDDEKKAGPLGGSSYEEEEEEEGGGGGERKVGGPHPKYDEDAKRPYFTVDEAEARQDGYG
DRTLGYQYDPEQLDLAENMVSQNDGSFISKKEWYV
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggctcggatggggcttgcgggcgccgctggacgctggtggggactcgctctcggcttg
accgccttcttcctcccaggcactcacacgcaggtggtgcaggtgaacgactccatgtat
ggcttcatcggcacagatgtggtactgcactgtagctttgccaacccactgcccagtgtg
aaaatcacccaggtcacatggcagaaggcctccaatggctccaaacagaacatggccatc
tacaacccgactatgggtgtgtccgtgctgcctccctacgagaaacgagtggagttcctg
cgaccctccttcatcgacggcaccatccgcctctccggtctggagctggaggacgagggc
atgtacatctgtgaatttgccaccttccctacgggcaaccgtgaaagccagctcaatctc
actgtgatggccaaacccaccaactggattgagggcacccgggcggtgcttcgagccagg
aagggacaggatgacaaggttttggtggccacctgcacctcagccaatgggaagcctccc
agtgcggtgtcctgggaaacacggctaaagggcgaggcagagtaccaggaaattcggaac
cccaatggcaccgtgacagtcatcagccgttaccgtttggtgcccagcagggaagcccac
cggcagtcgctggcctgcattgtcaactatcacctggaccgcttcagggagagccttacg
ctcaacgtgcagtatgaacctgaggtgaccattgagggctttgatggcaactggtacctg
cagcggacagatgtgaagctcacgtgcaaagcggatgctaacccgccagccactgagtac
cactggaccacattgaatggctctctccccaagggtgtagaggcccagaacaggaccctc
ttcttccggggacctatcacctacagcctggcaggaacctacatctgtgaggccaccaac
cctattggcacccgatcgggccaggtggaggtcaatatcacagaattcccctacaccccg
actcctgaacacgggcggcgcgccgggcagatgcccacagccatcattgggggcgtggca
gggagtgtcctgctggtgctgattgtggtcggagggatcatagtggccctgcgcaggcgc
cggcacaccttcaagggtgactacagcaccaagaagcacgtgtacggcaacggctacagc
aaggcaggcatcccgcagcatcacccgcccatggcacagaacctgcagtacccggatgac
tcggatgatgaaaagaaggccggcccattgggcgggagcagctatgaggaggaagaggag
gaggagggcggtggaggaggcgaacgtaaggtgggcggcccccaccccaaatatgacgag
gacgccaaacggccctacttcactgtggatgaggctgaggcccgtcaggacggctatggg
gaccggactctgggctaccagtatgaccctgaacagctggacttggctgagaacatggtt
tctcagaacgacgggtctttcatttccaagaaagagtggtatgtgtag

DBGET integrated database retrieval system