KEGG   Mus musculus (mouse): 58805Help
Entry
58805             CDS       T01002                                 

Gene name
Mlxipl, ChREBP, Mlx, WS-bHLH, Wbscr14, bHLHd14
Definition
(RefSeq) MLX interacting protein-like
  KO
K09113  MAX-like protein X
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    58805 (Mlxipl)
   04931 Insulin resistance
    58805 (Mlxipl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    58805 (Mlxipl)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    58805 (Mlxipl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Atg14 TolA_bind_tri zf-C4H2 DUF3584 ZapB NUDE_C bZIP_1
Motif
Other DBs
NCBI-GeneID: 58805
NCBI-ProteinID: NP_067430
MGI: 1927999
Ensembl: ENSMUSG00000005373
Vega: OTTMUSG00000025974
UniProt: Q99MZ3
LinkDB All DBs
Structure
PDB: 

Position
5; 5 G2
AA seq 864 aa AA seqDB search
MARALADLSVNLQVPRVVPSPDSDSDTDLEDPSPRRSAGGLHRSQVIHSGHFMVSSPHSD
SLTRRRDQEGPVGLADFGPRSIDPTLTHLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKI
RLNNAIWRAWYIQYVQRRKSPVCGFVTPLQGSEADEHRKPEAVILEGNYWKRRIEVVMRE
YHKWRIYYKKRLRKSSREGDFLAPKQVEGGWPPPERWCEQLFSSVVPVLLGGSEEEPGGR
QLLDLDCFLSDISDTLFTMTQPSPSSLQLPPEDAYVGNADMIQPDLTPLQPSLDDFMEIS
DFFTNYRPPQTPTSSNYIESPSFGPMADSLFSSGILAPEMPSPASSSSSSGMTPHSGNTR
LQARNSCSGPLDPNPFLSSEFLLPEDPKTKIPPAPGPTPLLPFPTPVKVHGLEPCTPSPF
PTMAPPPSLLPEESLLSARFPFTSAPPAPGVSTLPAPTTFVPTPQPGPGPVPFSVDHLPH
GYLEPVFGPHFTVPQGMQPRCKPSSPSPGGQKASPPTLASATASPTATATARDNNPCLTQ
LLRAAKPEQALEPPTMPGTLLRPPESPQDTVSEIPRARAFFPPIPAPTPPRPPPGPATLA
PPRSLVVPKAERLSPPASSGSERRLSGDLNSIQPSGALSVHLSPPQTVLSRGRVDNNKME
NRRITHISAEQKRRFNIKLGFDTLHGLVSTLSAQPSLKVSKATTLQKTAEYILMLQQERA
AMQEEAQQLRDEIEELNAAINLCQQQLPATGVPITHQRFDQMRDMFDDYVRTRTLHNWKF
WVFSILIRPLFESFNGMVSTASLHSLRQTSLAWLEQYCSLPALRPTVLNSLRQLSTSTSI
LTDPSLVPEQATRAVTEGTLGRPL
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgcgctggcggatctatccgtgaacttgcaggtcccccgggtcgtccctagc
ccggactcggactcggatacggacttggaggatccgagtccccggcgcagcgcgggtggc
ctgcatcgatcacaggtcatccacagcggacacttcatggtgtcttcgccgcacagcgac
tcgctgacccggcgacgcgaccaggaggggcccgtggggctcgccgacttcgggccgcgc
agcatcgatccgacactcacccacctcttcgagtgcttgagcctggcttacagtggcaag
ctggtctctcccaagtggaagaacttcaaaggcctcaagttgctatgccgggacaagatc
cggctgaacaacgccatctggagagcctggtacattcagtatgtgcaacggaggaagagc
ccagtgtgtggtttcgtgacccctctgcaggggtctgaagcagatgagcaccggaaacct
gaggctgtcatcctggagggtaattactggaagcggcgcatcgaggtggtgatgcgcgaa
taccacaagtggagaatctactacaaaaagcggctccgtaagtccagcagggaaggggat
ttcctggctcccaagcaggtggaaggtgggtggccgccaccagagcgatggtgcgaacag
ctcttctccagcgtggtgcctgtgctgcttgggggctccgaggaggagcctgggggccgg
cagcttctagacctggactgcttcttgtccgatatctccgacacactcttcaccatgaca
cagcccagtccttcgtccctgcagctgcccccagaagatgcttatgttggcaatgctgac
atgatccagccagacctgacgccgctgcagcccagcctagatgacttcatggagatatca
gatttcttcaccaattaccgcccccctcagacacccacatcttcaaactacatagagtcc
cccagctttggccccatggctgactccctcttcagcagtgggatcctggccccagagatg
ccatctccagcctcgtcttcctcctcctcagggatgacccctcactcagggaatacacgc
ctacaggctcggaacagctgctctggacccttggatcccaacccctttctgagctctgaa
ttccttcttcctgaagaccctaagaccaagatcccacctgctcctggaccgacccctctc
cttccattccccacccctgtcaaggtgcatggcttagagccctgcaccccctctcccttc
cccacaatggctccgcccccctctttgttgccagaagaatctctcctctctgccaggttc
ccattcacctcagcccctcctgctccaggagtgtctacgcttcctgcacccacaaccttt
gtccccaccccacagcccggccctggtcccgtccccttctctgtagaccatctgccccat
gggtacctggaacccgtctttgggcctcacttcactgtgcctcagggtatgcaacccagg
tgcaagccctcctccccatcccctgggggacaaaaagcaagtccacccaccttggcctct
gccaccgccagtcccactgccactgccactgccagagacaacaacccctgtcttacacag
ctgctcagggcagccaagcctgagcaagcactggagcctccgactatgcccggtaccctc
ctccggcctccagagtccccgcaggatacagtttctgaaatcccccgtgcccgtgccttt
ttccccccaatcccggcccctacaccaccccggccacctccaggcccagccacattggct
cctcccaggtccctggttgtccccaaagcagagcggctctcgcctccagcctccagcggc
agtgagcggcgactatcaggggatctcaactccatacaaccctcgggggcactgagtgtc
cacctgtctccccctcaaactgtcctaagccggggtcgtgtagacaacaacaagatggag
aaccgacgtatcacacacatctccgcggagcagaagaggcggttcaatattaagctagga
ttcgacaccctgcacggacttgtcagcacgctcagtgcccagcccagcctcaaggtgagc
aaagcaaccacgcttcagaagacagcggagtacatcctgatgctgcagcaggaacgggca
gctatgcaggaggaggcgcagcagctgcgggatgaaatagaggagctcaacgctgccatc
aacttgtgccagcagcagctaccggccaccggggtgcccatcacacatcagcgctttgac
cagatgcgggacatgtttgatgactatgtccggacgcgcacgctgcacaactggaagttc
tgggtgttcagcatcctcatccgacctttatttgaatccttcaatgggatggtgtctacc
gccagcttgcacagcctccgccagacctcactggcctggctggaacagtactgttcccta
cctgctctccggccaactgtcctgaattcccttcgccaactcagcacttccacaagcatc
ctgactgaccccagccttgtgcctgagcaagccacacgggcagtcacagagggcaccctg
gggagaccattataa

DBGET integrated database retrieval system