KEGG   Mus musculus (house mouse): 58998
Entry
58998             CDS       T01002                                 
Symbol
Nectin3, 2610301B19Rik, 3000002N23Rik, 4921513D19Rik, AA407785, AU016832, AW538082, CD113, Pvrl3
Name
(RefSeq) nectin cell adhesion molecule 3
  KO
K06592  poliovirus receptor-related protein 3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    58998 (Nectin3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    58998 (Nectin3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    58998 (Nectin3)
   04090 CD molecules [BR:mmu04090]
    58998 (Nectin3)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  Nectin family
   58998 (Nectin3)
CD molecules [BR:mmu04090]
 Proteins
  58998 (Nectin3)
SSDB
Motif
Pfam: C2-set_2 Ig_3 ig V-set I-set Ig_2 Ig_6 C1-set PDGLE
Other DBs
NCBI-GeneID: 58998
NCBI-ProteinID: NP_067470
MGI: 1930171
Ensembl: ENSMUSG00000022656
UniProt: Q9JLB9
Structure
LinkDB
Position
16:complement(46208028..46318898)
AA seq 549 aa
MARTPGPAPLCPGGGKAQLSSAFPPAAGLLLPAPTPPPLLLLLIPLLLFSRLCGALAGSI
IVEPHVTAVWGKNVSLKCLIEVNETITQISWEKIHGKSTQTVAVHHPQYGFSVQGDYQGR
VLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDS
LIDGGNETVAAVCVAATGKPVAQIDWEGDLGEMESSTTSFPNETATIVSQYKLFPTRFAR
GRRITCVVKHPALEKDIRYSFILDIQYAPEVSVTGYDGNWFVGRKGVNLKCNADANPPPF
KSVWSRLDGQWPDGLLASDNTLHFVHPLTVNYSGVYVCKVSNSLGQRSDQKVIYISDPPT
TTTLQPTVQWHSSPADVQDIATEHKKLPFPLSTLATLKDDTIGTIIASVVGGALFLVLVS
ILAGVFCYRRRRTFRGDYFAKNYIPPSDMQKESQIDVLHQDELDSYPDSVKKENKNPVNN
LIRKDYLEEPEKTQWNNVENLTRFERPMDYYEDLKMGMKFVSDERYNESEDGLVSHVDGS
VISRREWYV
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggcgcggaccccgggcccggccccgttgtgtcctggaggcggcaaagcacaactttcc
tcggcgtttcctcccgcggccggactgctgctgccggccccgacgccgccgccgctgctg
ctgctgcttattcccctgcttctcttctcccggctctgtggtgccttagctggatcaatt
attgtggagccacatgtcacagcagtgtggggaaagaatgtttcattgaagtgtttaatt
gaagtgaatgaaactataacccagatctcatgggagaagatacatggcaaaagtacacag
actgttgcagttcatcatcctcagtatggattctctgttcaaggagattatcagggaaga
gtcttgtttaaaaactattcacttaatgatgcaacaattactctgcataacataggcttc
tcagattctggaaaatatatatgcaaagccgttacattcccacttggaaatgctcagtcc
tctacaacagtgactgtgttagttgaacccacagtgagcctgataaaagggccggattct
ttaattgatggagggaatgagacagtagcagccgtttgtgtagcagccactggaaagcca
gtcgcacagattgactgggaaggtgatcttggtgaaatggaatctagtacaacttctttt
cctaatgaaacagcaacgattgtcagccaatacaagctgtttcccacaagatttgctcga
ggaaggcgaattacttgtgttgtaaaacatccagccttagaaaaggacattcgctactct
ttcatactagacatacagtatgctcctgaagtttcagtaacaggatatgatggaaattgg
ttcgtgggaagaaaaggtgttaacctcaagtgtaatgctgatgcaaaccctccacccttc
aagtccgtgtggagcaggttggatggacaatggcctgatggtttattggcgtcagataat
actcttcattttgtccatccattgactgtcaattattctggcgtttatgtctgtaaagta
tcaaattcccttggtcaaagaagtgatcaaaaggttatctacatttcagatcctcctacc
accaccacccttcagccgacagttcagtggcattcctcacctgctgacgtccaggatata
gcaacagagcataaaaaattgccctttcctttgtcaactttggcaacacttaaggatgac
acaattggcaccatcattgctagtgtagtgggtggggctctcttcttagtgcttgtgagc
attttagctggggtattctgctataggagacgacggacgtttcgtggagactactttgcc
aaaaactacattccaccatcagacatgcagaaagaatcacagattgatgttcttcaccag
gatgagctggattcttacccagacagtgtaaaaaaggaaaacaaaaatccagtaaacaac
ctgatccgcaaagactacttagaggagcctgagaaaactcagtggaataatgtagagaac
ctcactaggtttgaaagaccgatggattactatgaagatctaaaaatgggaatgaagttt
gtcagtgatgaacgctacaatgaaagtgaagatggtttggtttctcatgtagatggctcc
gtaatttccaggagggagtggtatgtctaa

DBGET integrated database retrieval system