Mus musculus (house mouse): 621893 Help Entry 621893            CDS       T01002                                  Symbol H2ac21, EG621893, H2a-613a, Hist2h2ab Name (RefSeq) H2A clustered histone 21   KO K11251   histone H2A Organism mmu  Mus musculus (house mouse) Pathway mmu03082   ATP-dependent chromatin remodeling mmu04217   Necroptosis mmu04613   Neutrophil extracellular trap formation mmu05034   Alcoholism mmu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mmu00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     621893 (H2ac21)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     621893 (H2ac21)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     621893 (H2ac21)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     621893 (H2ac21)   09165 Substance dependence    05034 Alcoholism     621893 (H2ac21)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmu03036]     621893 (H2ac21)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmu04147]     621893 (H2ac21) Chromosome and associated proteins [BR:mmu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     621893 (H2ac21) Exosome [BR:mmu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    621893 (H2ac21) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  621893 NCBI-ProteinID:  NP_835585 MGI:  2448314 Ensembl:  ENSMUSG00000063689 UniProt:  Q64522 LinkDB All DBs Position 3:96127201..96127634 Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TESHKPGKNK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgtggcaaacaaggaggcaaggcccgcgccaaggcgaagtcgcggtcgtcc cgcgccgggctgcagttcccggtggggcgtgtgcaccggctgctgcgcaagggcaactac gcggagcgcgtgggcgccggcgcgccggtgtacatggcggcggtgctggagtacctaacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccgcgccatctgcaactagctgtgaggaacgatgaggagctcaacaagttactaggggga gtcaccatcgcccagggcggggtcctccccaatattcaggctgtcttacttccgaagaaa acggaaagtcataagcctggaaagaacaaataa

DBGET integrated database retrieval system