Mus musculus (house mouse): 64654 Help Entry 64654             CDS       T01002                                  Symbol Fgf23, Fgf8b Name (RefSeq) fibroblast growth factor 23   KO K22428   fibroblast growth factor 23 Organism mmu  Mus musculus (house mouse) Pathway mmu04010   MAPK signaling pathway mmu04014   Ras signaling pathway mmu04015   Rap1 signaling pathway mmu04020   Calcium signaling pathway mmu04151   PI3K-Akt signaling pathway mmu04810   Regulation of actin cytoskeleton mmu04928   Parathyroid hormone synthesis, secretion and action mmu05200   Pathways in cancer mmu05218   Melanoma mmu05224   Breast cancer mmu05226   Gastric cancer Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     64654 (Fgf23)    04014 Ras signaling pathway     64654 (Fgf23)    04015 Rap1 signaling pathway     64654 (Fgf23)    04020 Calcium signaling pathway     64654 (Fgf23)    04151 PI3K-Akt signaling pathway     64654 (Fgf23)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     64654 (Fgf23)  09150 Organismal Systems   09152 Endocrine system    04928 Parathyroid hormone synthesis, secretion and action     64654 (Fgf23)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     64654 (Fgf23)   09162 Cancer: specific types    05226 Gastric cancer     64654 (Fgf23)    05218 Melanoma     64654 (Fgf23)    05224 Breast cancer     64654 (Fgf23)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmu04052]     64654 (Fgf23)    00536 Glycosaminoglycan binding proteins [BR:mmu00536]     64654 (Fgf23) Cytokines and neuropeptides [BR:mmu04052]  Cytokines   Growth factors (RTK binding)    64654 (Fgf23) Glycosaminoglycan binding proteins [BR:mmu00536]  Heparan sulfate / Heparin   Growth factors/receptors    64654 (Fgf23) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  64654 NCBI-ProteinID:  NP_073148 MGI:  1891427 Ensembl:  ENSMUSG00000000182 UniProt:  Q9EPC2 Q3U1V5 LinkDB All DBs Position 6:127049865..127059257 Genome browser AA seq 251 aa AA seqDB search MLGTCLRLLVGVLCTVCSLGTARAYPDTSPLLGSNWGSLTHLYTATARTSYHLQIHRDGH VDGTPHQTIYSALMITSEDAGSVVITGAMTRRFLCMDLHGNIFGSLHFSPENCKFRQWTL ENGYDVYLSQKHHYLVSLGRAKRIFQPGTNPPPFSQFLARRNEVPLLHFYTVRPRRHTRS AEDPPERDPLNVLKPRPRATPVPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARGGAGG ADRCRPFPRFV NT seq 756 nt NT seq  +upstreamnt  +downstreamnt atgctagggacctgccttagactcctggtgggcgtgctctgcactgtctgcagcttgggc actgctagagcctatccggacacttccccattgcttggctccaactggggaagcctgacc cacctgtacacggctacagccaggaccagctatcacctacagatccatagggatggtcat gtagatggcaccccccatcagaccatctacagtgccctgatgattacatcagaggacgcc ggctctgtggtgataacaggagccatgactcgaaggttcctttgtatggatctccacggc aacatttttggatcgcttcacttcagcccagagaattgcaagttccgccagtggacgctg gagaatggctatgacgtctacttgtcgcagaagcatcactacctggtgagcctgggccgc gccaagcgcatcttccagccgggcaccaacccgccgcccttctcccagttcctggctcgc aggaacgaggtcccgctgctgcatttctacactgttcgcccacggcgccacacgcgcagc gccgaggacccaccggagcgcgacccactgaacgtgctcaagccgcggccccgcgccacg cctgtgcctgtatcctgctctcgcgagctgccgagcgcagaggaaggtggccccgcagcc agcgatcctctgggggtgctgcgcagaggccgtggagatgctcgcgggggcgcgggaggc gcggataggtgtcgcccctttcccaggttcgtctag

DBGET integrated database retrieval system